KEGG   Sinorhizobium americanum: SAMCFNEI73_pC0345Help
Entry
SAMCFNEI73_pC0345 CDS       T04621                                 

Gene name
gsiA
Definition
(GenBank) glutathione import ATP-binding protein GsiA
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
same  Sinorhizobium americanum
Pathway
same02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:same00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAMCFNEI73_pC0345 (gsiA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:same02000]
    SAMCFNEI73_pC0345 (gsiA)
Transporters [BR:same02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    SAMCFNEI73_pC0345 (gsiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_22 SMC_N AAA_21 AAA_16 RsgA_GTPase AAA_29 DUF87 ATP-synt_ab DUF2666 FtsK_SpoIIIE Mg_chelatase AAA_24 AIG1 AAA_10
Motif
Other DBs
NCBI-ProteinID: APG94067
UniProt: A0A1L3LVD4
LinkDB All DBs
Position
C:378524..380188
Genome map
AA seq 554 aa AA seqDB search
MAASIQAVSVHDAALSVRGLTVDLPKGMERTHAVENISFDLKRGQILCIIGESGSGKSVT
ANTIMGLLPKLIPVSSGAIHLDGTAIIGAPAKTLRGLRGRVVSMIFQDPLSALNPLMTVG
EQITEVLTAHGVGTKASRRSRAIELLSEVGLPDPELMYYQYPFRLSGGQRQRVMIAMALA
LEPTVLIADEPTTALDVTTQAQILKLIRDIQRRKGMSVMFITHDFGVVAEIADSVVVMEK
GRVVEQGTAEQVLKSPTHPYTQRLIAAVPHLTGEDRVVQEKASNETILKVEGLSKTYCSG
SALFGSQRIVPAVKDVSFELAAGRTLGVVGESGSGKSSLGRLLIKLQDSDGGRILFEGRD
IARLSESEFRPLRPRIQMIFQDPFASLNPRSTIGQILTVGPVAHGMPYAQAREEARGLLA
RVGLDAGAFGRYPHEFSGGQRQRIGIARALMFKPKLLIADEAVSALDVSIQAQILKLLDQ
IQRETGVSMIFITHDLRVASQICDEIAVMQKGRIVEHGPPSQIFLNPQSAYTRELVTAIP
GERPRSTRPAAANV
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggccgctagcatccaggctgtttccgtacacgacgcagcgctttcggtgcgtgggctg
acagtcgacttgccgaaaggcatggagcggacccacgccgtcgagaacatctcgtttgat
ctcaagcggggccagatcctgtgcattatcggcgagtccggctcaggcaagtcggtaacg
gcaaacacgatcatggggcttctgccgaagctgatccccgtctcgtccggtgctattcat
ctcgatggcacggccatcatcggcgcaccggcgaaaacactgcgaggactgcgcggccgc
gtcgtatccatgattttccaggatccgctctcggcgcttaacccgctgatgacggtcggc
gagcagattaccgaagtcctgacggcacatggtgtgggcacgaaggcgtcgcggcgcagc
cgcgccatcgaactgctgagcgaagtcggtctgcccgatccggagctcatgtactaccag
tatccgttccggctttcgggcgggcaacgccagcgcgtgatgatcgccatggcgctggcg
ctcgagcccacggtcctgatcgccgacgaaccgaccacggccctcgacgtcaccacgcag
gcgcagatcctgaagctgatccgagacattcagcgccgcaagggcatgagcgtgatgttc
attacccatgacttcggtgtcgtggctgagatcgccgacagtgtcgtggtgatggaaaag
ggccgcgttgtcgagcaaggcaccgccgagcaggttctcaaatcccccacccacccctac
acccagcgcctgatcgccgccgtcccgcacctgactggcgaggatcgagtcgttcaggaa
aaggcgagcaacgagacgatcctgaaggtcgaaggattgtccaagacttattgcagcggc
agtgccctgttcggcagccagcgtatcgtgccggctgtcaaggatgtttcattcgaactg
gccgcaggacgcacgctcggcgttgtcggcgaaagcggctccggcaagtcatcgctcgga
aggcttttgatcaagctgcaggacagcgatggcggccgcattctgttcgagggccgcgac
atcgccaggctgtcggaatcggaattccgtccgctgcggccgcggatccagatgatcttc
caggatcccttcgcgtcgctcaatccgcgttcgactataggacaaatcctgaccgtaggc
cccgtcgcgcacggcatgccctacgctcaggcgcgtgaggaggcgcgggggctgctggcc
cgtgtcggtctcgatgccggcgccttcggacgttatccgcacgagttttccggtgggcaa
cgccagcgcatcggcatcgcccgggccttgatgttcaagcccaagctgttgattgccgac
gaggcagtctctgcgctcgacgtctctatccaggcccagatcctcaagctgctagaccag
atccagcgggaaaccggcgtgtcgatgattttcatcacccatgatctgcgcgtcgcaagc
cagatctgcgacgaaattgcggtgatgcaaaaagggcggatcgtcgagcacggcccgccg
tcccaaatctttctgaacccgcaatcggcgtacacgcgcgagctggtgaccgcgattccc
ggggagcgaccgaggagcacccggccggctgctgcgaacgtttaa

DBGET integrated database retrieval system