KEGG   Sinorhizobium americanum: SAMCFNEI73_pC1614Help
Entry
SAMCFNEI73_pC1614 CDS       T04621                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
same  Sinorhizobium americanum
Pathway
same00010  Glycolysis / Gluconeogenesis
same00020  Citrate cycle (TCA cycle)
same00620  Pyruvate metabolism
same01100  Metabolic pathways
same01110  Biosynthesis of secondary metabolites
same01120  Microbial metabolism in diverse environments
same01130  Biosynthesis of antibiotics
same01200  Carbon metabolism
Module
same_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMCFNEI73_pC1614 (acoC)
   00020 Citrate cycle (TCA cycle)
    SAMCFNEI73_pC1614 (acoC)
   00620 Pyruvate metabolism
    SAMCFNEI73_pC1614 (acoC)
Enzymes [BR:same01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAMCFNEI73_pC1614 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: APG95318
UniProt: A0A1L3LZ16
LinkDB All DBs
Position
C:complement(1723411..1724697)
Genome map
AA seq 428 aa AA seqDB search
MATEVILPKVDMDMATGKISKWFFGEGDAVKEGDVLFEIETDKAAMEIDAPASGVLRNVT
GKEGVDIPVGSAVAWIYAEGETVNETAVPLAPPATAESPLPVSEAKTPAAEVTVEQKVDS
APRATPLARRLARERELDLARLNGSGPRGRIVSADVLGASNMLVDARAQADPAAVQSEAP
GSTAGENALRHFPDGSYELQAHSSMRRTIARRLVEAKSSVPHFYLKADCRLDALLKLRAE
LNAAAPLVENVPAYKLSVNDLVIKAYALALAGAPDANVSWMDEHLVRHSHSDVGVAVSVP
GGLITPIIRQAEQKSLSTISNEMKDLAARAKAGKLKPNEYQGGTGAVSNLGMYGVKEFAA
IINPPHSTILAVGAGEKRPVVTAEGELGVATVMSVTLSTDHRAVDGALGAELLAKFRALI
ENPLSMLV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgaagtcattttgccgaaggtcgacatggacatggcgacgggcaagatctcg
aagtggttcttcggcgagggcgatgccgtgaaggagggcgatgtccttttcgagatcgag
accgacaaggcggccatggaaatcgacgcgccggcgagcggggtcctgcgtaacgtgacc
ggcaaggaaggtgtggatatcccggtcggctcggccgtcgcgtggatctatgccgagggg
gagaccgtcaacgagacggccgtccctcttgcgccgccggccaccgccgaaagtccgctg
ccggtgtctgaagcaaagacgccggccgcggaggtcacagtcgaacagaaagttgacagc
gcaccccgcgccacgccgctcgcacgacgcctcgcgcgggagcgagagctggatcttgcc
aggctgaacggcagcggcccgcgtggccgcatcgtcagtgccgatgtcctgggggcctcc
aacatgctcgtcgatgcccgggcacaggcggatcccgcagcggttcaatcggaggctccg
gggagcaccgcaggcgagaacgcgcttcggcattttcccgatgggtcctacgaacttcag
gcgcacagctccatgcgtcggacgatcgcacggcggctcgtcgaggccaagagcagtgtt
ccgcacttctaccttaaggctgactgccggctcgacgcgctcctgaaattgcgcgcggag
ctcaatgctgcggcgccgctggtcgagaacgtgccggcctacaagctctcggtgaacgac
ctcgtcatcaaggcttacgcactggctctggcgggtgctccggacgctaacgtgtcttgg
atggacgagcatctggtgcgccacagccattcggatgtcggcgtggcggtttccgtcccc
ggtgggcttatcaccccgatcatccgccaggcggagcaaaagagcctttcgaccatctcg
aacgagatgaaagacttggccgcgcgtgccaaggcaggaaagctgaagcccaacgagtac
cagggcggcacgggagcggtgtcaaacctcggaatgtacggcgtgaaggaattcgccgcg
atcatcaatcccccccactccacgatcctggcggtcggcgccggagaaaagcggccggtg
gtaaccgcagaaggggagttgggcgttgctacggtcatgagcgtaacgctgtccacggat
catcgggccgtggatggtgcgctgggcgcagagcttctcgcgaagttccgcgcgctcatc
gagaatccattgagcatgctggtctag

DBGET integrated database retrieval system