KEGG   Sinorhizobium americanum: SAMCFNEI73_pC1820Help
Entry
SAMCFNEI73_pC1820 CDS       T04621                                 

Definition
(GenBank) two-component response regulator protein
  KO
K02483  two-component system, OmpR family, response regulator
Organism
same  Sinorhizobium americanum
Brite
KEGG Orthology (KO) [BR:same00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:same02022]
    SAMCFNEI73_pC1820
Two-component system [BR:same02022]
 OmpR family
  Unclassified
   SAMCFNEI73_pC1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: APG95521
UniProt: A0A1L3LZM4
LinkDB All DBs
Position
C:1940473..1941210
Genome map
AA seq 245 aa AA seqDB search
MEHIDHILIVDDDREIRELVSSYLKKNGLRVTAVADGRQMRAFLEANTVDLIILDLMMPG
DDGLVLSRELRVGRHKATPIVMLTARSDEMDRIIGLEMGADDYLAKPFSARELLARIKAV
LRRARMLPPNLQISEAGQLLRFGQWKLDTTARHLIDADGTVIALSGAEYRLLRVFVDHPQ
RVLNRDQLLNLTQGRDAELFDRSIDLLVSRVRQRLGDDAREPTYIKTVRSEGYVFSMPVE
IVEPR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatcgaccacatcttgatcgttgatgacgatcgggaaatccgggagcttgtg
tcgagctacctgaagaagaacggcctgcgcgtcaccgccgtcgccgacgggcggcagatg
cgcgcgttcctcgaggccaacacggtcgacctcatcatcctcgacctgatgatgccaggc
gacgatgggctggttttgagccgcgagctgcgcgtcggtagacacaaggcgacaccgatt
gtcatgctgactgcccgctccgacgagatggaccgcatcatcggtctcgaaatgggcgcc
gacgactatctcgccaagccgttttcggcacgcgagttgctcgcccgcatcaaggcggtc
ctgcggcgcgcgcgcatgctgcctcccaacctgcagatctcggaagccggccagctgctg
cgtttcggtcaatggaagctcgacaccacggcaaggcacctgatcgatgcggacggcacg
gtgattgcgctcagcggagccgaataccggctgctgcgcgtcttcgtcgaccatccccag
cgcgtcctcaaccgagaccaattgctcaatctgacgcagggacgcgacgccgaactcttt
gaccgctccatcgatctcctggtcagccgggttcgccagcgcctcggcgacgatgcccgc
gagccgacctacatcaagacggtccgcagcgaaggctatgttttctcgatgccggtcgaa
atcgtggaaccgcgctga

DBGET integrated database retrieval system