KEGG   Sandaracinus amylolyticus: DB32_000113Help
Entry
DB32_000113       CDS       T03935                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
samy  Sandaracinus amylolyticus
Pathway
samy00473  D-Alanine metabolism
samy00550  Peptidoglycan biosynthesis
samy01100  Metabolic pathways
samy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:samy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DB32_000113
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DB32_000113
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DB32_000113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:samy01011]
    DB32_000113
Enzymes [BR:samy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DB32_000113
Peptidoglycan biosynthesis and degradation proteins [BR:samy01011]
 Precursor biosynthesis
  Amino acid ligase
   DB32_000113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 RimK B12-binding
Motif
Other DBs
NCBI-ProteinID: AKF02965
UniProt: A0A0F6VYW3
LinkDB All DBs
Position
complement(136232..137272)
Genome map
AA seq 346 aa AA seqDB search
MRRGIDVAAAHRDMRVTILTYVEHAGEAPDVVVPQVEDALRSKGHEVAVLPVHDELERFI
GELRDHRPDLVFNLLEMFADDLLLEVPAAGVYDLLHVPHTGGGPGEFYLAQDKALAKKLL
AYEQILYPRFAVFPKHAGLETGGNLRMPLFVKPLCADASIGIDSHALVHDANELMRRVLK
IHDEVNDAALAEEYIEGREVYVGVIGNAEPIALPPIEVDFSGMPEGALHVLDRAAKWETE
SAAYKGTKSVVAKLEPELEARVKKVAVDAYRALRVRDYGRVDLRLAPTGEIYVIEVNPSC
YLERSSELAMAAKAAGIEYEDLVQKIVDLAIERHHPRAKERRRAGK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcggcatcgacgttgcagccgcgcaccgcgacatgcgcgtcacgatcctcacg
tacgtcgagcacgcgggcgaagcaccggacgtcgtcgtcccgcaggtcgaggacgcgctg
cgcagcaagggccacgaggtcgccgtgctgccggtgcacgacgagctcgagcgcttcatc
ggcgagctgcgcgatcaccgcccagacctcgtcttcaacctgctcgagatgttcgccgac
gacctcctgctcgaggtgccggcggccggcgtctacgacctgctgcacgtgccgcacacc
ggcggcgggcccggcgagttctatctcgcgcaggacaaggcgctcgcgaagaagctgctc
gcgtacgagcagatcctctacccgcgcttcgcggtgttcccgaagcacgccgggctcgag
accggcggcaacctgcgcatgccgctcttcgtgaagccgctctgcgccgacgcgtcgatc
ggcatcgactcgcacgcgctggtgcacgacgcgaacgagctgatgcggcgcgtgctgaag
atccacgacgaggtcaacgacgccgcgctcgccgaggagtacatcgaggggcgcgaggtc
tacgtcggcgtgatcggcaacgcggagccgatcgcgctgccgccgatcgaggtggacttc
tcgggcatgcccgagggcgcgctccacgtgctcgaccgcgcggcgaagtgggagaccgag
agcgccgcctacaagggcacgaagtcggtggtggcgaagctcgagcccgagctcgaggcg
cgcgtgaagaaggtcgcggtggacgcgtaccgcgcgctgcgggtgcgcgactacgggcgc
gtcgatctgcggctcgcgccgaccggcgagatctacgtgatcgaggtgaacccgagctgc
tacctcgagcgctcgagcgagctcgcgatggccgcgaaggccgcgggcatcgagtacgag
gacctcgtgcagaagatcgtggacctcgcgatcgagcgtcatcacccgcgcgcgaaggag
cgccgccgcgccgggaagtga

DBGET integrated database retrieval system