KEGG   Sandaracinus amylolyticus: DB32_001499Help
Entry
DB32_001499       CDS       T03935                                 

Definition
(GenBank) beta-lactamase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
samy  Sandaracinus amylolyticus
Brite
KEGG Orthology (KO) [BR:samy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DB32_001499
Enzymes [BR:samy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DB32_001499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AKF04350
UniProt: A0A0F6W0H8
LinkDB All DBs
Position
complement(1741674..1742837)
Genome map
AA seq 387 aa AA seqDB search
MRSHSPARSSFVLGVFTSLGLVVGCTSETPTFDTATVSRFESALASTQTSEGSAGTLMLV
EDGAGRRWVGATGAADLEADTPATEDTLFRSASIAKTFTGALVLSLHEEGLLSIDDPIST
YVPRVPRGDEITLRMLLQHTSGIVSYTRTPPYQEALASDRTRTFTADELIDMAIAEPADF
PPGAAWNYSNTGYILLGVAVESVVGRSIADECTARFFVPLGMTDTRALSSGTPDALWSSY
VPGGAAGPAAVVTPTSYAADGGYVTSLHDMAIWAREFLGGRLHRRETLALADVPAGGAVL
EGVAQAYGYETGGYGMGYVVALDPALGDVRLGAGNTDGARTFVGYSTDADVGFVVAVNVG
EGAAPLVETLSAARPLLAAVRETFGSR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcgcactcgccagctcgctcttccttcgtcctcggtgtcttcacgtcgctcggt
ctcgtcgtcggatgcacctcggagacgcccacgttcgacaccgcgacggtgtctcgcttc
gagtccgcgctggcctcgacgcaaacgtccgagggctccgccggcacgctcatgctcgtc
gaggacggcgcgggacggcgctgggtcggagccaccggcgcggccgacctggaggccgac
acgccggcgaccgaagacacgctcttccgctcggcgagcatcgcgaagacgttcacgggc
gcgctcgtgctgtcgctccacgaagagggcctcctctcgatcgacgacccgatctccacg
tacgtgccgagggtgccgcgcggcgacgagatcacgctgcggatgctgctccagcacacc
tcggggatcgtcagctacacgcggacgccgccctatcaagaggcgctcgcgtcggaccgg
acgcgcacgttcacggccgacgagctgatcgacatggcgatcgcggagcccgcggacttc
ccgcccggcgcggcgtggaactactcgaacaccggctacatcctgctcggcgtcgcggtg
gagtccgtcgtcggccggtcgatcgccgacgagtgcacggcgcggttcttcgtgcccctc
ggcatgaccgacacgcgcgcgctctcgagcgggacgcccgacgcgctctggagcagctac
gtgcccggcggcgcggccgggcccgcggccgtcgtgacgccgacgagctacgccgccgac
ggcggctacgtcacgtcgctccacgacatggcgatctgggcgcgtgaattcctcggcggg
cgcctccatcgccgcgagacgctcgcgctcgccgacgtgccggcgggcggcgccgtgctc
gagggcgtcgcgcaggcctatggctacgagacgggcggatacgggatgggatacgtggtc
gcgctcgatcctgcgctcggcgacgtccgcctgggcgctgggaacaccgacggtgcacgc
acgttcgtcggctattcgaccgacgccgacgtcggcttcgtcgtcgccgtcaacgtcggc
gagggcgcggcgccgctcgtcgagacgctctcggccgcgcgcccgctgctcgcggcggtg
cgagagacgttcggctcgcgctga

DBGET integrated database retrieval system