KEGG   Sandaracinus amylolyticus: DB32_005756Help
Entry
DB32_005756       CDS       T03935                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
samy  Sandaracinus amylolyticus
Pathway
samy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:samy00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    DB32_005756
Enzymes [BR:samy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DB32_005756
DNA repair and recombination proteins [BR:samy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DB32_005756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: AKF08607
UniProt: A0A0F6YKP4
LinkDB All DBs
Position
complement(6676284..6678008)
Genome map
AA seq 574 aa AA seqDB search
MGLETYRQKRDFARTPEPSGKVRKKTGWSFVVQKHAASRMHYDFRLELDGVLLSWSVPKG
PSYDVEEKRLAVQTEDHPVEYGTFEGIIPEGEYGGGTVMLWDRGTWEPVGDPRVGMEKGK
LDFVLHGERLEGRWTLVRLKSRPEDRGRANWLLFKRSDEHVAEHEGEEITDVALTSVKSG
RSMDEIAEAKGRSRKVWHSNRGSSEGVPSAKARIRAAAREGRVKHAAKTVRAPAEPVPSE
PAKKKKATKKPRAHTPPRKWDVAPREGAYRGPTRAPRRDTGAREKVAGVGISNGGRVVDP
GSGITKIEVARYYAEVAHCFLAHAADRALALVRCPEGSAGQCFYQKHSHPGMSEHIHVAH
APWGEEVLSVRTQPGVVALAQWSAIELHGWSARVDAIEKPDWIVMDLDPAEDVGFAEVVE
GALTLRERLSSIGLESFVKTTGGKGLHVVVPLMRRHGWDVVKDFAHALALDISHRAPDRY
LAEMSKSKRTGRIFVDYLRNGRGNTAILPYSARARDGLPVAMPLAWSEIEKVTPAQFDVR
SAPKWIAKRRRDPWAAMRSVRQSITREILDALAT
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgggactcgagacgtatcgccagaaacgcgacttcgcgcgcacgcccgagccgagcggc
aaggtccgcaagaagacgggctggtccttcgtcgtgcagaagcacgctgcgtcgcgcatg
cactacgacttccggctcgagctcgacggagtgctcctgagctggtcggtgccgaagggc
ccgagctacgacgtcgaggagaagcgcctcgcggtgcagaccgaggatcatccggtcgag
tacggcacgttcgaagggatcatcccggagggcgagtacggcggcggcaccgtgatgctg
tgggatcgcggcacgtgggagcccgtcggcgatccacgcgtcggcatggagaagggcaag
ctcgacttcgtgctgcacggcgagcgcctcgagggacgctggacgctcgtgcggctcaag
tcgcgtcccgaggatcgtggccgcgcgaattggttgctgttcaaacgatcggacgagcac
gtcgcggagcacgagggcgaggagatcaccgacgtcgcgctcacgagcgtgaagagcggt
cggtcgatggacgagatcgccgaagcgaagggacgctcgcgcaaggtctggcactcgaac
cgcggctcgagcgagggcgtgccgagcgcgaaggcgcgcatccgcgccgcggcgcgcgaa
ggtcgcgtgaagcacgccgcgaagacggtgcgcgcgcccgccgagcccgtgccctccgag
ccggcgaagaagaagaaggccacgaagaagccgcgcgcgcacacgccgccgcgcaagtgg
gacgtcgcaccgcgcgagggcgcgtaccgaggcccgacccgcgcgccgcgccgcgacacg
ggcgcgcgcgagaaggtcgccggcgtcggcatcagcaacggcgggcgcgtcgtcgatccc
ggcagcggcatcacgaagatcgaggtcgcgcgctactacgccgaggtcgcgcactgtttc
ctcgcgcacgcggccgatcgcgcgctcgcgctcgtgcgctgtcccgagggctcggcgggg
cagtgcttctaccagaagcactcgcaccccggcatgagcgagcacatccacgtcgcgcac
gcgccgtggggcgaagaggtcctctcggtgcgtacgcagcccggcgtggtcgcgctcgcg
cagtggagcgcgatcgagctgcacggctggagcgcgcgcgtcgacgccatcgagaagccc
gactggatcgtgatggacctcgatcccgcggaggacgtggggttcgccgaggtcgtcgag
ggcgcgctcacgctgcgcgagcggctctcgtcgatcgggctcgagtcgttcgtgaagacg
acgggcggcaagggcctccacgtcgtcgtgccgctgatgcgccgtcacggctgggacgtg
gtgaaggacttcgcccacgcgctcgcgctcgacatcagccatcgcgcaccggaccgctat
ctggccgagatgtcgaagtccaagcgcaccgggcgcatcttcgtcgactacctgcgcaac
gggcgcgggaacaccgcgatcctgccctactcggcgcgcgcgagagacggcctgccggtc
gcgatgccgctcgcgtggtcggagatcgagaaggtcacgccggctcagttcgacgtgcgc
tccgcgccgaagtggatcgcgaagcggaggcgcgatccttgggcagcgatgcgcagcgtg
aggcagtcgatcacgcgagagatcctggacgcgctcgcgacgtga

DBGET integrated database retrieval system