KEGG   Sandaracinus amylolyticus: DB32_006304Help
Entry
DB32_006304       CDS       T03935                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
samy  Sandaracinus amylolyticus
Pathway
samy00473  D-Alanine metabolism
samy00550  Peptidoglycan biosynthesis
samy01100  Metabolic pathways
samy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:samy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DB32_006304
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DB32_006304
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DB32_006304
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:samy01011]
    DB32_006304
Enzymes [BR:samy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DB32_006304
Peptidoglycan biosynthesis and degradation proteins [BR:samy01011]
 Precursor biosynthesis
  Amino acid ligase
   DB32_006304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 GARS_A ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AKF09155
UniProt: A0A0F6W756
LinkDB All DBs
Position
7295294..7296370
Genome map
AA seq 358 aa AA seqDB search
MLCCDPASPLKARGDEDFDYEHADASDRAFLRALEDAGYEASWHPVHLANVDTVVDALDC
DVVFNLCDGSGQGIDNYPGVEAIDAIERRGLPYTGSRREPYRTSISKVTMKTRFVAAGVP
TPKWQLLASPDEPLLDDLRGVPLFVKPHDAGGSAGVHLSSIIAADDELALRARVEEIFRD
YGSALVEEYVDGREITVGLLGSGERAKALPPLEVRFGDAFPPGKGIRTHETKWDTSSPLY
GSFELLCPAPLTLAETRRVLRVARDAYRAIDGAGYGRVDMRVDHRGPFVLEVNMNCSLEY
GESSADCAMYPFAAQAAGLAFPELLRRLVEDAKRFHRAASPARRARRVVSLEARRRRR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgctctgctgcgatcccgcctcgccgctgaaggctcgaggcgacgaggacttcgactac
gagcacgccgacgcgtccgatcgcgcgttcctccgcgcgctcgaggacgcgggctacgaa
gcgagctggcacccggtgcacctcgcgaacgtcgacacggtcgtcgacgcgctcgactgc
gacgtggtgttcaacctgtgcgacgggtcgggtcagggcatcgacaactatccaggtgtc
gaggccatcgacgcgatcgagcggcgcgggctgccctacaccggatcgcggcgcgagccg
tatcgcacgtcgatctcgaaggtcacgatgaagacgcgcttcgtcgcggcgggcgtgccc
acgccgaagtggcagctcctcgcgtcgcccgacgagccgctgctcgacgatctgcggggc
gtgccgctcttcgtgaagccgcacgacgcgggcgggagcgcgggcgtgcacctctcgtcg
atcatcgcggccgacgacgagctcgcgctgcgcgcgcgcgtcgaggagatcttccgcgac
tacggctcggcgctggtcgaggagtacgtcgacggccgcgagatcacggtcgggctgctc
ggatcgggcgagcgcgcgaaggcgcttccgccgctcgaggtgcgcttcggtgacgcgttc
ccgccgggcaaggggatccgcacccacgagacgaagtgggacacgagctcgccgctctac
gggagcttcgagctgctgtgtccggcgccgctcacgctcgcggagacgcggcgcgtgctg
cgcgtggcgcgcgacgcgtaccgcgcgatcgacggagcgggctacgggcgcgtcgacatg
cgcgtcgatcaccgcgggccgttcgtgctcgaggtgaacatgaactgctcgctcgagtac
ggagagagctcggccgactgcgcgatgtacccgttcgccgcgcaggcggcggggctcgcg
ttccccgagctgctgcggcgcctggtggaggacgcgaagcgcttccatcgcgcggcgtct
ccggcgcggcgcgcgcggcgggtcgtctcgctcgaagcgcggcgccgtcgtcgctga

DBGET integrated database retrieval system