KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0673Help
Entry
gbs0673           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00030  Pentose phosphate pathway
san00630  Glyoxylate and dicarboxylate metabolism
san01100  Metabolic pathways
san01120  Microbial metabolism in diverse environments
san01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:san00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    gbs0673
   00630 Glyoxylate and dicarboxylate metabolism
    gbs0673
Enzymes [BR:san01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     gbs0673
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     gbs0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase DHO_dh DUF2099
Motif
Other DBs
NCBI-ProteinID: CAD46317
UniProt: Q8E6A4
LinkDB All DBs
Position
690298..690915
Genome map
AA seq 205 aa AA seqDB search
MLNQLKNNYFFAVIRGKSSEDALEIAKHAILGGIRNIEVTFSTPEASKVIKQLSDDFKNN
KKIIVGAGTVMTTQLAKDAIDAGAKFLVSPHFDSDIANLANENKVYYFPGCATATEIVVA
RKYKCQIIKLFPGGVVGPDFIKDIHGPIPDVDLMPSGGVSVSNVAEWRKAGAVAVGVGSA
LSSKVATEGYDSVTKIAKQFVSALD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcaattgaaaaacaactatttcttcgctgttattcgaggaaaatcatctgag
gatgcactagaaatcgcaaagcatgctattttaggtggtattcggaatattgaagtaact
ttttcgactcctgaagcaagcaaagtcatcaaacaattatcagatgactttaaaaataat
aaaaaaattattgtgggggccggaacggttatgacaactcaacttgctaaagatgctatt
gatgctggagctaaatttttggttagcccacactttgattcagatattgctaatttagct
aatgaaaacaaggtttattatttcccaggctgtgcaacggcaacagaaatcgtggtagct
agaaagtataaatgtcagattataaagctttttccaggtggagttgtgggcccagatttt
atcaaagatattcatggtcctattccagatgttgatttaatgccatcaggtggcgtctct
gtttcaaatgtagctgaatggagaaaagcaggagcagttgcggttggtgttggctcagca
ttatctagtaaagtagccacagaaggctatgatagtgttactaaaatagctaaacagttt
gtttctgcacttgattag

DBGET integrated database retrieval system