KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0681Help
Entry
gbs0681           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00500  Starch and sucrose metabolism
san01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:san00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    gbs0681
Enzymes [BR:san01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     gbs0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CAD46325
UniProt: Q8E696
LinkDB All DBs
Position
699619..701085
Genome map
AA seq 488 aa AA seqDB search
MTNELIMQAFEWYLPSDGNHWKKLEDSISDLKKLGVSKIWLPPAFKGTSSDDVGYGVYDL
FDLGEFDQNGTIRTKYGRKEEYLKLIKSLKANGIKPFADIVLNHKANGDHKEKFQVIKVN
PENRQEALSEPYEIEGWTGFDFPGRQGEYNDFKWHWYHFTGLDYDAKNNETDIFMIVGDN
KGWADDDLIDDENGNFDYLMYNDIDFKHPEVIKNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFINDIRTKIKPDLEVFGEYWKSDQTSMKDYLEATQFQFSLVDVTLHMNFFDASH
QNRDFDMRTIFDDSLVIDNPEYAVTFVENHDTQSGQALESRVEDWFKPLAYGLILLRQQG
TPCLFYGDYYGIQGEFGQPSFKEVIDKMAELRQNYVFGKQVDYFTHSNCIGWTCLGDEEY
NSCLAVVLTNGDQGWKHMEVGEIYAGKTFVDYLGNCEQEVVIGDDGWGDFLVESASISAW
VPKIEEAN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaattgataatgcaagcttttgagtggtatttacctagtgatgggaatcac
tggaagaaattagaggactctatatcagaccttaaaaaacttggagttagtaaaatctgg
ttaccaccagcatttaagggaactagcagtgatgatgtaggatatggtgtttatgatctc
tttgatttaggagaatttgaccagaatggaacaattagaacaaaatatggtaggaaagaa
gagtatctaaagcttattaagtcgttaaaggcaaatggcattaaaccatttgcagatatc
gttcttaaccataaagccaatggtgatcataaagaaaaatttcaagtcataaaagtcaat
cctgaaaatcgtcaagaagcattaagtgaaccctatgagattgaaggatggacgggattt
gatttcccaggtagacagggtgagtacaatgattttaaatggcactggtaccactttact
ggtttagattacgatgctaaaaataatgaaacagacatctttatgattgtaggcgataat
aaaggttgggcagacgatgatttgattgatgatgaaaatggtaatttcgattatctcatg
tacaatgacattgattttaagcatcctgaagttataaaaaacttacaagattgggctaag
tggtttattgaaactaccggtattgaaggttttcgtttggatgctgtgaaacatatcgat
tcttactttattcaaactttcattaatgatattcgtacaaaaataaaacccgatttagag
gtctttggcgaatattggaaatctgaccaaacatcaatgaaggactatttagaggcaaca
caatttcaattttctcttgttgatgttaccttgcatatgaatttttttgatgccagtcac
caaaaccgtgattttgatatgcgaacaatttttgatgatagtcttgttattgataatcct
gagtatgctgtcacattcgtagaaaatcacgatacgcaaagtggacaagctctagaaagt
agagtggaagattggtttaaacctttagcttatggcttgatacttttacgccaacaaggg
actccatgtcttttttatggtgattattatggcattcaaggagaatttggccaaccatcc
tttaaagaggttattgataaaatggctgagctacgccaaaactatgtatttggcaaacaa
gtcgattattttacgcattcaaattgtattggttggacttgtcttggggatgaggaatat
aattcttgtttagctgtggtcctaacaaatggtgatcagggatggaaacatatggaagta
ggggaaatttatgcaggcaaaacgtttgttgattatttaggtaattgtgaacaagaggtt
gttataggagatgatggttggggtgattttttagttgaatctgcgtctatctcggcttgg
gtccctaaaatagaggaagctaactga

DBGET integrated database retrieval system