KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs1875Help
Entry
gbs1875           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Brite
KEGG Orthology (KO) [BR:san00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    gbs1875
Enzymes [BR:san01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     gbs1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_8 NAD_binding_7 Lycopene_cycl Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: CAD47534
UniProt: Q8E386
LinkDB All DBs
Position
1939694..1941226
Genome map
AA seq 510 aa AA seqDB search
MVLDKEIKAQLAQYLDLLESDIVLQADLGDNDNSQKVKDFLDEIVAMSDRISLESTHLKR
QPSFGIAKKGHESRVIFSGLPMGHEFTSFILALLQVSGRAPKVDEDIIKRIKGIEKTINL
ETYVSLTCHNCPDVVQAFNIMAVLNPNITHTMIEGGMYQDEVKSKGIMSVPTVYKDQEEF
TSGRATIEQLLEQLDGPLDAEAFADKGVYDVLVIGGGPAGNSAAIYAARKGLKTGILAET
FGGQVIETVGIENMIGTLYTEGPKLMAQIEEHTKSYDIDIIKSQLATGIEKKELVEVTLA
NGAILQAKTAILALGAKWRNINVPGEEEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGM
EAALDLAGVTKHVTVLEFLPELKADQVLQERAAKTDNLTILKNVATKDIVGEDHVTGLNY
TDRDTNEEKHIDLEGVFVQIGLVPSTSWLKDSGIELNERQEIVVDKFGSTNIPGIFAAGD
CTDAAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtcttagataaagaaatcaaggctcaattagcgcaatatttagatttgctagaatct
gatattgtattacaagctgatttaggagataacgataattctcaaaaagtaaaggatttt
ctagatgaaattgtcgctatgtctgatcgcatcagccttgaatcaacacatttaaaacgt
caacctagttttggaattgcaaaaaaagggcatgaaagtcgcgttattttttcaggcttg
ccaatggggcatgaattcacatctttcattttagctttgttgcaagtctctggtcgcgca
ccaaaagttgatgaagatattatcaaacgaattaaggggattgagaaaactatcaatcta
gaaacttatgtttcattaacttgccataattgtccagatgtcgttcaagcctttaatata
atggctgttttgaatccgaatatcactcatactatgattgaaggaggcatgtatcaagac
gaagtcaaatcaaaaggtatcatgtctgttcctactgtttataaggaccaagaagaattt
acttctggccgtgctacaattgaacagcttttagaacaactagatggacctcttgatgct
gaagcatttgctgacaaaggtgtctatgatgttctagttattggtggtggtcctgcaggt
aacagtgctgcaatttatgccgcccgtaaagggttaaaaacaggtattttagcagaaact
tttggtggacaagttatcgaaacagttggtattgagaacatgattggtacactgtacaca
gaaggccctaaattaatggctcaaattgaagagcataccaaatcttacgatattgatatt
atcaagagtcaattagcaactggcattgagaaaaaagaattagttgaggtaacactggct
aacggagctattttacaagctaaaactgctatcctagctctgggtgctaagtggcgaaat
atcaacgttcctggcgaggaagaattccgcaataaaggtgttacttactgtccacattgt
gatggccctcttttcgaaggaaaagatgttgctgttataggtggtggtaattcaggtatg
gaagctgctttagatctagccggtgtcactaaacatgttacagtcctagaattcttacct
gagctcaaagcagaccaagtactgcaagaacgagcagctaaaactgacaatttaactatt
cttaagaatgttgctactaaagatatcgttggtgaagatcatgtcactggtttaaactat
accgatcgtgatacaaacgaagaaaaacacattgatttagaaggtgtttttgtacaaatt
ggtcttgtaccaagtacatcttggctcaaggatagcggcattgaactcaatgaacgtcaa
gaaattgtcgttgataaatttggctcaacaaatatccctggtatttttgctgcaggtgac
tgtacagatgctgcctacaagcaaatcattatttccatggggtctggtgccacagctgcc
attggcgcatttgattatttaatcagacaataa

DBGET integrated database retrieval system