KEGG   Streptococcus anginosus C238: SANR_0405Help
Entry
SANR_0405         CDS       T02829                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sanc  Streptococcus anginosus C238
Brite
KEGG Orthology (KO) [BR:sanc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SANR_0405 (ahpF)
Enzymes [BR:sanc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SANR_0405 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 Thi4 FMO-like Glutaredoxin Ribosomal_L21p NAD_binding_8 LPD7 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGU82885
LinkDB All DBs
Position
399293..400825
Genome map
AA seq 510 aa AA seqDB search
MALDETIKAQLKQYLELLESDVVFQASLGQDERSEQVRAFLEEIVAMSPRLSLENIETNR
KPSFTVTQVGQAGRVQFAGLPLGHEFTSFVLALLQVSGRAPKVEDAVIKRIQAIKQPLHF
ETYVSLTCHNCPDVVQALNVMAILNPNISHTMVEGGMFRQEVEDKKIMAVPTVFLNGEEF
ANGRMTIEQLLDKISGPASSEEFDQKEPFDVLVVGGGPAGSSAAIYAARKGIRTGMVVET
FGGQVMETVGIENMIGTPYTEGPKLMAQVEEHAKKYPIDIMKNQRVKNIEKKDLIEVELE
NGAVLKAKTAVLSVGARWRNVNVPGEEEFRTKGVTNCPHCDGPIFTGKKVAVIGGGNSGI
EAAIDLAGLAEHVYVLEFLPTLKADQVLQDRVQQLKNVTVLTHVATKEIHGSDQVEAITY
LDRANNEEHKIELSGVFVQIGLLPNTDWLKDSSVALNERGEIIVDKHGATNVPGIFAAGD
CTDSAYKQIIISMGSGATAALGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggctttagatgaaacaattaaagcacaactgaagcaatacctggaacttttagaatct
gatgttgtatttcaagcttctttaggtcaagatgagcgttctgagcaggtgcgggctttt
ctagaggaaattgtagcaatgtctccacgtttatcactggaaaatatagagactaaccgc
aagccaagttttaccgttacacaagtggggcaagcagggcgtgtgcagtttgcaggactt
cccttagggcatgaatttacatcttttgtgctggctttgctgcaagtctctggtcgcgca
ccaaaagtagaagatgctgttataaaacgaattcaagctattaagcagccacttcatttt
gaaacctatgttagcctaacctgccataattgtccagacgttgtgcaagctctcaatgtg
atggctattttgaatcctaatatcagccatacaatggttgaaggaggcatgtttagacaa
gaagttgaagacaaaaagattatggctgttccaacggtttttctaaatggtgaagaattt
gcaaatggtcgtatgaccattgagcaactgctcgacaagatttctggacctgcttcaagt
gaggaatttgaccaaaaagaaccatttgatgtattggttgttggaggcggacctgcagga
agcagcgcagctatttatgctgctcgtaagggaattcgtacagggatggtcgttgaaact
ttcggtggacaggtaatggagaccgttggtattgaaaatatgattggcacgccttacact
gaaggacctaagctaatggcgcaggtagaagaacatgccaagaaatatccaattgatatc
atgaagaatcaacgtgtgaaaaacatcgagaaaaaggatttgattgaagtggagcttgaa
aatggcgcagttctgaaagcaaaaacggccgttctttctgttggtgctcgctggcgaaat
gtcaacgtccctggtgaagaagaattccggacgaaaggtgtaaccaattgtccacattgc
gatggtcctatttttacaggtaaaaaagtggctgttatcggtggaggaaattctggaatt
gaagcagcaattgacttagctggtctggcagagcatgtttatgtgttagaatttctacca
actttgaaagccgatcaagtgttgcaagacagggtacagcaacttaaaaacgtgacagtt
ctaacccatgtagcaacaaaagaaattcatggttccgatcaagttgaagccattacttat
ctcgatcgtgcgaataatgaagaacataaaattgaactcagcggtgtctttgttcaaatt
ggtcttttgccaaatacagactggctcaaagatagctcagttgctcttaatgaacgcggt
gaaattattgttgacaaacatggtgcaacaaatgtgccaggaatttttgcagcaggtgat
tgtacagatagcgcttataaacaaatcattatttcaatgggttcaggagcaacggcagct
ttgggagcatttgattatttgattcgtcaataa

DBGET integrated database retrieval system