KEGG   Streptococcus anginosus C238: SANR_0521Help
Entry
SANR_0521         CDS       T02829                                 

Definition
(GenBank) putative ABC transporter permease
  KO
K02004  putative ABC transport system permease protein
Organism
sanc  Streptococcus anginosus C238
Brite
KEGG Orthology (KO) [BR:sanc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sanc02000]
    SANR_0521
Transporters [BR:sanc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter
    SANR_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX GPR_Gpa2_C
Motif
Other DBs
NCBI-ProteinID: AGU82996
LinkDB All DBs
Position
517786..519774
Genome map
AA seq 662 aa AA seqDB search
MLRLAGKLAVSNLVKNRRLYYPFTLATCLVVAISYIFNSLTFNPHLQKMQGASSISFVLA
LGVIIVTIAAAIIVFYANSFVMKNRSKELGLYGMLGLNKRHLFTMVFIELLILGATTVTI
GLGFGIVFDKLIYAFLLKLMGLKVVLVSTFQWLVLISVVVIYGVIFAGLVLVNGLRILRF
NALQLAKEKNSGERKGRFLLIQTIIGSISLGYAYYLALSVKNPLTAIGIFFIAVLFVILG
TYLLFNAGVTVFLQLLQKNKRYYYQPNNMISVSNLIFRMKKNAVGLATISILSTMVLVTL
AGGINIYAGADYLKTVMYPQDYTIKGKAVSAVQLDQALTEFAKENHLTVTKKNAYQYYSM
GIKNQKGIQLDIYPKGETRVSPQAYILLFSADDYRKMTGKTLNLKDNETVIFAKGISIRQ
TQPLKLNGQELIVKELLKEDFVLGNITDQYNIIIPQSLFMVVNDPQKLVDSQKQHYTINT
ELYGGLNIRASNKKKGDLDTAYQKKLKQFNTTLPDNAGVYGYTRIQGVQEIMSMLGGVFF
IGIFLSIVFMLGTVLVIYYKQISEGYEDRDRFVILQKVGLDEKQTKRTIRKQILTVFFLP
LAFAFVHLAFAYHMLSLMLKVLGVLNAALMLEVTLGVCAVFFIIYVLVFLITSRSYRRIV
SM
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
gtgcttagattagcgggaaaattagcggtttctaacctagtgaaaaatcgtagattatac
tatccatttacgttggcaacttgtttagtcgtcgctatttcatatatttttaattcttta
acgtttaatcctcatttacaaaaaatgcagggggcaagttctatttcatttgtcttggct
cttggagtgattattgtgacgattgctgcagcgattatcgttttttatgctaatagcttc
gtcatgaaaaatcgctcgaaagaactggggctgtatggaatgctaggacttaataaacgt
catctctttaccatggtgtttattgagttattgattttaggagcgacgactgtcacgatt
ggtcttggatttggtattgtatttgataaattgatttatgcctttttactgaaattgatg
gggttaaaagttgttctagtatccacgtttcaatggttagttcttatttcagttgttgtc
atctatggcgttatttttgcgggcttggtgcttgtcaacggtttgaggattctacgtttt
aatgctttgcaattggccaaggaaaagaatagcggtgaaagaaaaggacgatttcttctg
attcaaacgattattggatcgatttctttaggctatgcttattacctagctctgagtgtc
aaaaatccattgacagcaattggtatattttttatagctgttctctttgttattttaggg
acttatctgctgttcaatgcaggagttacggtatttttgcagttgctccagaaaaataaa
cgatattactatcaaccaaacaatatgatttctgtgtccaatttgatttttcggatgaag
aaaaatgcggttggcttagcaacgatttcgattttgtcaaccatggtcttagtcacctta
gctggtggtattaacatctacgctggtgctgattatctgaaaacagtgatgtacccccaa
gattatacgataaaggggaaggcagtgtcagctgttcaattggatcaggcattgacagaa
tttgcaaaagagaatcatttaacagtcactaagaaaaatgcttatcaatattattcgatg
ggaattaaaaatcaaaagggcattcagcttgatatttatccaaaaggtgaaacacgagtt
tctccacaggcctatattctgctgttttcagctgatgattatcggaaaatgacgggcaaa
acattgaatttaaaagataatgagacagtaatctttgcaaaaggaatctctatcaggcaa
actcagcctcttaagctgaacgggcaagaattgatagttaaagaacttttaaaagaggac
tttgttcttggaaacattacagatcagtataatatcattatccctcagtcactttttatg
gtggttaatgacccacaaaaattggtggattcccaaaagcaacattacacgattaataca
gagttatatggcggcttgaatatcagggcttctaataagaaaaagggcgatttggataca
gcttaccagaagaagctgaaacagttcaatacgacgctccccgataatgccggtgtgtat
ggttatacaagaatccaaggtgtgcaggaaattatgagtatgttaggtggcgttttcttt
attggtattttcctttcaattgtctttatgctgggaacggttttggtaatctactacaaa
cagatttcagaagggtatgaagaccgagaccgctttgtaattttacaaaaggtaggatta
gatgaaaagcaaaccaagcgcaccattcgcaaacaaattttgactgtgttcttcttaccg
cttgctttcgcttttgtgcatctggcatttgcttatcatatgctgagtctcatgttaaaa
gttctgggggtcttaaatgctgcattgatgttggaagttacgcttggcgtttgtgctgtt
ttctttatcatctatgtacttgtctttctcatcacatcacgcagttatcgtagaattgtg
tcgatgtga

DBGET integrated database retrieval system