KEGG   Streptococcus anginosus C238: SANR_1118Help
Entry
SANR_1118         CDS       T02829                                 

Gene name
amy
Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sanc  Streptococcus anginosus C238
Pathway
sanc00500  Starch and sucrose metabolism
sanc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SANR_1118 (amy)
Enzymes [BR:sanc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SANR_1118 (amy)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AGU83574
LinkDB All DBs
Position
1146722..1148170
Genome map
AA seq 482 aa AA seqDB search
MENQTLMQYFEWYLPNDGQHWNRLATDAPHLASKGIRKVWMPPAFKATSSNDVGYGIYDL
FDLGEFDQKGTVRTKYGFKEDYLNAIKALKENGIEPIADIVLNHKAAADYKERFTVIEVD
PNDRTVALSEPFEIKGWTKFTFPGRHKKYNDFEWHWYHFTGTDYDAKRNKSGIYLIQGDN
KGWADDDLVDNENGNFDYLMYADLDFKHPEVIQNLYDWADWFIETTGIHGFRLDAIKHID
SFFMGNFIRDIMAKYGEDFYVFGEFWNGDETANNDYLGSIDYRFDLVDVKLHHNLFDASR
AGADYDLRNIFEQTLVKNHPKSAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLREAG
LPCVFYGDYYGIKGEFAQDSFQTVLDKLLDIRLNLAYGKQKDYFDDEHCIAWTRSGKDNG
QPIAVILTNDQASSKRMYVGKNWAGKKFKDYLGNSSSTVTIKKDGWADFPVAEKSVSVWS
AQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaacattaatgcaatattttgaatggtatctaccaaatgacggacaacat
tggaatcgtttggcaacagacgctccacatctagcttctaaaggcattcgcaaggtttgg
atgccacctgcttttaaagccactagttccaacgatgtcggctacggcatttatgattta
tttgacttaggcgagtttgaccaaaaaggaacggttcggacaaagtatggctttaaggaa
gactatttgaacgcaatcaaggcactcaaagaaaatggaattgaacccattgcagatatc
gttttaaatcacaaggcggcagcggattacaaagagagatttactgttattgaagttgac
ccaaatgatcgtacagtcgccctctctgagccttttgaaataaaaggctggaccaagttc
acattccccggtcgccataaaaaatacaatgattttgaatggcattggtaccactttaca
ggtacggattatgatgctaagcgaaataaatcagggatttacctaattcaaggggacaac
aaaggttgggctgacgatgatttagtggacaatgaaaatggaaatttcgactatctcatg
tacgctgaccttgattttaagcacccagaagtcattcaaaacctttatgattgggcagat
tggtttatcgaaacgaccggcattcatggctttagactggacgctatcaagcatattgac
tctttctttatgggaaattttatccgcgacattatggcgaagtatggagaagacttctat
gtctttggagagttttggaatggtgatgaaactgcaaataacgattatttaggaagtatt
gactaccgttttgatctcgtagatgtcaaactgcaccacaacttatttgatgctagccgc
gctggggcggactatgatttgagaaatatttttgaacaaacgcttgtcaaaaaccaccct
aaatcggctgttacttttgtcgataatcatgacacacaacgtggacaagcactggaatca
actgttgaagaatggtttaaacctgctgcttacgctctcattttgttgcgtgaagcaggc
ctgccttgcgttttctatggagattactatggtatcaaaggcgaattcgctcaagacagc
ttccaaacagttcttgataaattattagatattcgtctcaacttagcctatggaaaacag
aaagattattttgacgatgagcattgcattgcttggacccgttcaggcaaagacaacgga
cagccgattgctgtcatcttaacaaacgatcaagccagttcaaaacgcatgtatgtcggt
aaaaattgggctggtaagaaattcaaagattacttaggaaacagctcatcaaccgtgaca
atcaaaaaagacggctgggcagatttcccagttgcagaaaaatcagttagcgtctggtct
gcgcaataa

DBGET integrated database retrieval system