KEGG   Streptococcus anginosus C238: SANR_1182Help
Entry
SANR_1182         CDS       T02829                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sanc  Streptococcus anginosus C238
Pathway
sanc00473  D-Alanine metabolism
sanc00550  Peptidoglycan biosynthesis
sanc01100  Metabolic pathways
sanc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sanc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SANR_1182
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SANR_1182
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SANR_1182
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sanc01011]
    SANR_1182
Enzymes [BR:sanc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SANR_1182
Peptidoglycan biosynthesis and degradation proteins [BR:sanc01011]
 Precursor biosynthesis
  Amino acid ligase
   SANR_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGU83633
LinkDB All DBs
Position
1215126..1216124
Genome map
AA seq 332 aa AA seqDB search
MKKLIKSYLEKFDKECKKTNLFLVANLQMQTKKMSYYTIEHASDSEFFSLSEFEEIASAL
LKTGLCLNVFYTEIDFVEYILKHYSYLSKETLLVYNLARDGRKEGKKSLIPSFCDYFGID
YTGSNALTVSLCRNKFIWGAVADRFNIPTPKTVCIKGGEVLGEPFETQKYIRKEISESAS
INLSNDSIVDNFEWKNIGKTDFLLQEYISGIEVEVPFFNIKGEYLVLNPVKIVSSSEILT
SELSDSNSYSFEMLENQQICTELKKATKKLAKYLGITTYGRVDFRIKSDGSYFVFDIATM
PYTTDHSSFNYNFEQYGFTMTDVHKLVILSSL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagttaataaaatcttaccttgaaaaatttgacaaagaatgcaaaaaaactaat
ctatttttggttgccaatttgcaaatgcaaactaaaaaaatgtcttattatacaattgaa
catgcatctgatagtgaatttttttcgctatcagaatttgaggagatagcctcagcattg
ttaaaaactggattatgtttgaatgttttttacactgaaatagatttcgtagaatatata
ttaaaacactattcatacttatcaaaagaaacattattagtttataatttggctagagat
ggacgaaaagaaggaaaaaaatcgttgattccatctttttgtgactattttggtattgat
tatacaggttccaatgcgctaacggtttcattatgtcgtaataaatttatttggggagct
gttgcagataggtttaatattccaacacctaaaacggtttgtataaaaggtggcgaagta
ttaggtgagccttttgaaactcaaaaatatattagaaaagagatttcagaatcagcaagt
attaatctttccaatgattcaatcgtagataattttgagtggaaaaatattggaaaaaca
gattttcttttgcaagagtatatttcaggaattgaagttgaagtcccattttttaatatt
aaaggagagtatcttgtattaaatccagtaaaaatcgtatcttcttcagaaattttgaca
agcgaactatctgatagtaatagctattcatttgaaatgttagaaaatcagcaaatatgt
acggaattaaaaaaggcaacaaaaaaactcgccaagtatttaggtataacgacttacgga
cgagttgattttagaataaagtcagatgggagttattttgtattcgatattgcaacaatg
ccttacacaactgaccatagttcatttaattataacttcgaacaatatggatttacaatg
accgatgttcacaaactagtaatactaagtagtttataa

DBGET integrated database retrieval system