KEGG   Streptococcus anginosus C238: SANR_1653Help
Entry
SANR_1653         CDS       T02829                                 

Gene name
aspC
Definition
(GenBank) putative aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sanc  Streptococcus anginosus C238
Pathway
sanc00220  Arginine biosynthesis
sanc00250  Alanine, aspartate and glutamate metabolism
sanc00290  Valine, leucine and isoleucine biosynthesis
sanc01100  Metabolic pathways
sanc01110  Biosynthesis of secondary metabolites
sanc01130  Biosynthesis of antibiotics
sanc01210  2-Oxocarboxylic acid metabolism
sanc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sanc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SANR_1653 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    SANR_1653 (aspC)
   00220 Arginine biosynthesis
    SANR_1653 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sanc01007]
    SANR_1653 (aspC)
Enzymes [BR:sanc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SANR_1653 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     SANR_1653 (aspC)
Amino acid related enzymes [BR:sanc01007]
 Aminotransferase (transaminase)
  Class I
   SANR_1653 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AGU84068
LinkDB All DBs
Position
complement(1733996..1735210)
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSTKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKNIPNVDIEDVYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEAADWYPDIDDIKSKITSNTKAIVVINPNNP
TGALYPKAVLEELVEVARQNNLIIFADEIYDRLVMDGEKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKYHVKDYIEGLNMLSNMRLCSNVLSQHVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINEIPGLSATKPKAGLYIFPKIDREMYRVDDDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaataaatcaacaaaattagaacatgtggcttatgatattcgtggtccc
gtcttagaagaagctatgcggatgcgtgcaaacggtgagaaaatccttcggttgaacaca
ggaaacccagctgagtttggttttacagcgccagatgaggtgattcatgacttgattatg
aatgcgcgtgatagtgagggatattctgactcgaaagggattttttctgctcggaaagct
attatgcaatattgtcaattgaaaaatattcctaatgttgatattgaagatgtttacctt
ggaaatggggttagcgagctgattgtcatgtctatgcaaggtttgttagataatggcgat
gaggtattggttccgatgccggattatccactctggaccgcagcggtcagtttagcagga
ggaaatgcagttcattatctttgtgatgaagcggcagattggtatccagatattgatgac
atcaaatcaaaaattacctctaatacaaaggctattgtcgttatcaacccaaacaatccg
acaggagccttgtatcctaaggcagtgttagaagaacttgttgaagttgcgcggcaaaac
aacttgattatttttgcggatgagatttatgaccgtttagtgatggatggtgagaaacat
acggctatcgcaagtttggctcctgaccttttttgtgtcagcatgaatggcttgtctaaa
tcgcaccgtatcgcgggttttcgtgtagggtggatggtgctatctggaccaaaatatcat
gtaaaagattatattgaagggctgaatatgctatccaatatgcggttgtgttcaaatgtc
ttatctcagcatgtggtacaaacgtcactcggcggttatcaatcagtcgatgaattgttg
cttcctggtggtcgtatttatgagcaacggaattttatttacaaggctatcaatgaaatt
ccgggtttgtcggcaaccaaacctaaagcggggctttatatttttcccaaaattgataga
gaaatgtatcgagtagatgacgatgagcaattcgtgctggatttcttaaagcaagaaaag
attttactggtgcatggacggggctttaattggaaagatcctgatcatttccggattgtt
tatctgcctcgtgtagatgagttagcacaaatccaagagaagatgactcgtttcttaaaa
caatatcgacgatga

DBGET integrated database retrieval system