KEGG   Streptococcus anginosus C1051: SAIN_0393Help
Entry
SAIN_0393         CDS       T02828                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sang  Streptococcus anginosus C1051
Brite
KEGG Orthology (KO) [BR:sang00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAIN_0393 (ahpF)
Enzymes [BR:sang01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SAIN_0393 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 Thi4 FMO-like Glutaredoxin Ribosomal_L21p NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGU81149
LinkDB All DBs
Position
402018..403550
Genome map
AA seq 510 aa AA seqDB search
MALDETIKAQLKQYLELLESDVVFQASLGQDEHSEQVRAFLEEIVAMSPRLSLENAETNR
KPSFTVTQIGQAGRVQFAGLPLGHEFTSFVLALLQVSGRAPKVEDAVINRIQAIQSPLHF
ETYVSLTCHNCPDVVQALNVLAILNPNISHTMVEGGMFRQEVEDKKIMAVPTVFLNGAEF
ANGRMTVEQLLDKISGPASSEEFDNKEPFDVLVVGGGPAGSSAAIYAARKGIRTGMVVET
FGGQVMETVGIENMIGTPYTEGPKLMAQVEEHAKKYPIDIMKNQRVKNIEKKDLIEVELE
NGAVLKAKTAVLSVGARWRNVNVPGEEEFRTKGVTNCPHCDGPIFTGKKVAVIGGGNSGI
EAAIDLAGLAEHVYVLEFLPTLKADQVLQDRVQQLKNVTVLTNVATKEIHGSDQVEAITY
LDRANNEEHKIELSGVFVQIGLLPNTDWLKNSSVALNERGEIIVDKHGATNVPGIFAAGD
CTDSAYKQIIISMGSGATAALGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggctttagatgaaacaattaaagcgcaactgaagcaatatttggagcttttagaatct
gatgttgtatttcaagcttctttaggtcaagatgagcattctgagcaggtgcgggctttt
ctagaggaaattgtagcaatgtctccacgtttatcattggaaaatgcagaaactaaccgc
aagccaagttttactgttacacaaattggtcaagcagggcgtgtgcagtttgcagggctt
cccttgggacatgaatttacatcttttgtgctggctttgctgcaagtctctggtcgcgca
cccaaagtagaagatgctgttataaaccgaattcaggctatccaatccccgcttcatttt
gaaacttatgtcagcttaacctgtcataattgtccagacgttgtgcaagctctcaatgtg
ctggctattttgaatcctaatatcagccatacaatggttgaaggaggcatgtttagacaa
gaagttgaagataaaaagatcatggctgttccaacggttttcctaaatggtgcagaattt
gcgaatggtcgtatgacagttgagcaactgcttgataagatttctggacctgcttcaagt
gaggaatttgacaataaagaaccatttgatgtgttggttgttggaggcggacctgcaggg
agcagtgcagcgatttatgccgctcgtaaaggcattcgtactggtatggtcgttgaaact
tttggtggacaggtgatggagaccgttggtattgaaaatatgattggtactccttataca
gaaggacctaagctgatggcgcaggtagaagaacatgccaagaaatatccaattgatatc
atgaagaatcaacgtgtgaaaaacatcgagaaaaaggatttgattgaagtggagcttgaa
aatggcgcagttctgaaagcaaaaacggccgttctttctgttggtgctcgctggcgaaat
gtcaacgtccctggtgaagaagaattccggacgaaaggtgtaaccaattgtccacattgc
gatggtcctatttttacaggtaaaaaagtggctgttatcggtggaggcaattctggaatt
gaagcagcaattgacttagctggtctggcagagcatgtttatgtactagaatttctacca
actttgaaagctgatcaagtgttgcaagacagggtacagcaacttaaaaacgtgacggtt
ctaaccaatgtagctacaaaagaaattcatggttccgatcaagttgaagccattacttat
ctcgatcgtgcgaataatgaagaacataaaattgaactcagcggtgtctttgttcaaatt
ggtcttttgccaaatacagattggcttaagaatagttcagttgctttaaatgagcgtggt
gaaatcattgttgacaaacatggtgcaacaaatgtgccaggaatttttgcagcaggtgat
tgtacagatagcgcttataaacaaatcattatttcaatggggtcaggagcaacagcagct
ttgggggcatttgattatttgattcgtcaataa

DBGET integrated database retrieval system