KEGG   Streptococcus anginosus C1051: SAIN_0872Help
Entry
SAIN_0872         CDS       T02828                                 

Gene name
mutX
Definition
(GenBank) mutator MutT protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
sang  Streptococcus anginosus C1051
Brite
KEGG Orthology (KO) [BR:sang00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sang03400]
    SAIN_0872 (mutX)
Enzymes [BR:sang01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     SAIN_0872 (mutX)
DNA repair and recombination proteins [BR:sang03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    SAIN_0872 (mutX)
 Prokaryotic Type
    SAIN_0872 (mutX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AGU81616
LinkDB All DBs
Position
909455..909925
Genome map
AA seq 156 aa AA seqDB search
MVKLATICYIDNGKEFLLLHRNKKPNDVHAGKWIGVGGKLEKGETPQECAVREIFEETGL
RVNKPVLKGIITFPDFIPNHDWYTYVFKVTEFEGGLIDCDEGTLEWVPYEQVLSKPTWEG
DHTFLSWILEDKPFFSAKFSYKGEKLVESHVDFYGE
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggttaagttagcaacgatttgctatattgacaacggcaaagaatttttattgctacat
cgaaataaaaagcctaatgatgttcatgctggtaagtggattggtgttgggggtaaatta
gagaaaggtgaaacgccgcaggagtgcgctgtaagagaaatctttgaagaaacaggtttg
cgggtcaataagccagtattaaaaggtattatcacgtttccagattttatacctaaccat
gattggtatacctatgtatttaaagtgacggagtttgagggaggcttgattgactgcgat
gaggggactttggaatgggtgccttatgaacaagttttgtccaaaccaacttgggaggga
gatcatacgtttctatcttggattttagaagataaaccattcttctcggctaaattttct
tacaaaggagagaagttggtggagagtcatgttgatttttatggagaataa

DBGET integrated database retrieval system