KEGG   Streptococcus anginosus C1051: SAIN_0949Help
Entry
SAIN_0949         CDS       T02828                                 

Gene name
acoC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sang  Streptococcus anginosus C1051
Pathway
sang00010  Glycolysis / Gluconeogenesis
sang00020  Citrate cycle (TCA cycle)
sang00620  Pyruvate metabolism
sang01100  Metabolic pathways
sang01110  Biosynthesis of secondary metabolites
sang01120  Microbial metabolism in diverse environments
sang01130  Biosynthesis of antibiotics
sang01200  Carbon metabolism
Module
sang_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAIN_0949 (acoC)
   00020 Citrate cycle (TCA cycle)
    SAIN_0949 (acoC)
   00620 Pyruvate metabolism
    SAIN_0949 (acoC)
Enzymes [BR:sang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAIN_0949 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CAT
Motif
Other DBs
NCBI-ProteinID: AGU81693
LinkDB All DBs
Position
complement(993544..994614)
Genome map
AA seq 356 aa AA seqDB search
MNYLRMRENMDDKKLRATPAARKLADDLGINLYDVSGTGAKGRIHKEDIESYREFNIVKI
TPLAKRIAEENNIAWQEIQGTGVHGRIMKKDILALLPENVDSDSIKSPAQIEKAEEIPDN
TTPYGEIKRLPMTPMRKVIAKRMVDSYLTAPTFTLNYDVDMTELLALRKRVLETIMEATG
KKMTVTDLLSMAVVKTLMKHPYLNSSLTEDGQTIIMHNYVNLAMAVGMDNGLMTPVVYNA
EKMSLSELVVAFKDVIERTLNGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILG
VSSTVEKPVVVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISMLV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaattatttaagaatgagagagaacatggatgacaaaaaattaagagcgacccctgct
gctagaaaattagcagatgatttgggtatcaatctctatgacgtatctggtactggcgca
aagggacgcattcacaaagaagatattgaaagttatcgagaattcaatattgtgaaaatt
acgccccttgcaaaacgtattgcagaagaaaataacatcgcttggcaggaaatccaaggg
acaggcgtgcacggcaggattatgaaaaaggatattctggctttgctgcctgaaaatgtt
gactcagacagtatcaagtctccggctcaaattgagaaagcggaagaaatacctgacaac
accactccttatggagaaattaagcgccttccaatgacgccaatgcggaaggtcattgct
aaacgaatggtggattcttatctgacagcaccaactttcactctcaattatgatgtagat
atgacagagttgctggcgctgcgcaagagggttttagagacaattatggaagcgacagga
aagaaaatgacggttacggatttactttctatggcagttgtcaaaactttgatgaagcac
ccttatcttaattcgtctctgacagaggacgggcaaaccattatcatgcacaattatgtc
aatctggctatggctgttgggatggacaatgggcttatgacaccagtggtttacaatgcc
gaaaaaatgagtctgtctgagttagtcgttgcctttaaggatgtgattgaacggacttta
aatggaaaattagcaccaagcgaattgcaaaactcaacttttacgattagtaatctagga
atgtttggtgttcaatcgttcggcccaattatcaatcaacccaattcagcgattttggga
gttagctcaaccgttgaaaaaccagtcgtagtgaacggagagattgttattcgaccaatc
atgagtcttggattaactattgaccaccgagttgtggacggtatggcaggtgctaaattc
atgaaagatctaaaagcactgattgaagatccgatttcaatgttggtgtaa

DBGET integrated database retrieval system