KEGG   Streptococcus anginosus C1051: SAIN_1427Help
Entry
SAIN_1427         CDS       T02828                                 

Gene name
aspC
Definition
(GenBank) putative aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sang  Streptococcus anginosus C1051
Pathway
sang00220  Arginine biosynthesis
sang00250  Alanine, aspartate and glutamate metabolism
sang00290  Valine, leucine and isoleucine biosynthesis
sang01100  Metabolic pathways
sang01110  Biosynthesis of secondary metabolites
sang01130  Biosynthesis of antibiotics
sang01210  2-Oxocarboxylic acid metabolism
sang01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sang00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAIN_1427 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    SAIN_1427 (aspC)
   00220 Arginine biosynthesis
    SAIN_1427 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sang01007]
    SAIN_1427 (aspC)
Enzymes [BR:sang01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SAIN_1427 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     SAIN_1427 (aspC)
Amino acid related enzymes [BR:sang01007]
 Aminotransferase (transaminase)
  Class I
   SAIN_1427 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AGU82146
LinkDB All DBs
Position
complement(1476916..1478130)
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSTKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKNIPNVDIDDVYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEAADWYPDIDDIKSKITSNTKAIVVINPNNP
TGALYPKEVLEELVEVARQNNLIIFADEIYDRLVMDGEKHIAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKYHVKDYIEGLNMLSNMRLCSNVLSQHVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINEIPGLSAVKPKAGLYIFPKIDREMYRVDDDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaataaatcaacaaaattagaacatgtggcttatgatattcggggcccc
gtcttagaagaagctatgcggatgcgtgcaaatggtgagaaaatccttcggttgaacaca
ggaaacccagctgagtttggttttacagcgccagatgaggtgattcatgacttgattatg
aatgcgcgtgatagcgagggatattcggactcgaaagggattttttctgctcggaaagct
attatgcaatattgtcaattgaaaaatattcctaatgttgatattgatgatgtctacctt
ggaaatggagtcagcgagttgattgtcatgtctatgcaaggtttgctggataatggcgat
gaggtattggttccgatgccggactatccactctggaccgcagcggtcagtttagcggga
ggaaatgcagttcattatctttgtgatgaagcggcagattggtatccggatattgatgat
atcaaatcaaaaattacctctaatacaaaggctattgtcgttatcaacccaaacaatccg
acaggagctttgtatccaaaagaggtgttggaagagcttgttgaagttgcgcggcaaaac
aacttgattatttttgcagatgagatttatgatcgtttagtaatggacggtgaaaagcat
atagctatcgcaagtttagctcctgatcttttctgtgttagtatgaacggtttgtctaaa
tcgcaccgtatcgcgggttttcgtgtagggtggatggtgctatctggtcctaaatatcac
gtgaaagattatattgaagggctgaatatgctatccaatatgcggttgtgttcaaatgtc
ttatctcagcatgtggtacaaacgtcgcttggaggttatcaatcagttgatgaattgctg
cttcctggcggacggatttatgagcaacggaattttatttataaagctatcaatgaaatt
ccaggtctatctgcagtaaaacctaaagcggggctttatatttttcctaaaattgatagg
gaaatgtatcgagtagatgacgatgagcaattcgtgctggatttcttaaagcaagaaaag
attttactggtgcatggacgaggttttaactggaaagacccagatcattttcgtattgtt
tatctgcctcgtgtagatgaattggcacaaattcaagagaaaatgactcgtttcttaagg
caatatcgtagatga

DBGET integrated database retrieval system