KEGG   Streptococcus anginosus C1051: SAIN_1432Help
Entry
SAIN_1432         CDS       T02828                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sang  Streptococcus anginosus C1051
Pathway
sang00473  D-Alanine metabolism
sang01100  Metabolic pathways
sang01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sang00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAIN_1432 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SAIN_1432 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sang01011]
    SAIN_1432 (alr)
Enzymes [BR:sang01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SAIN_1432 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sang01011]
 Precursor biosynthesis
  Racemase
   SAIN_1432 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TIG UEV
Motif
Other DBs
NCBI-ProteinID: AGU82151
LinkDB All DBs
Position
complement(1483636..1484787)
Genome map
AA seq 383 aa AA seqDB search
MQVILLQLVLFWRNIMKTSNHRPTKVIVDLAAIRFNIKQITAHIPDNVEKWAVVKADAYG
HGAVAVTQSIESIVDGFCVSNIDEAVELREAGISKKILVLGVSDVSAISLAIERKVTCTV
ASLEWLDLLLQSNIDVAGLIVHIKIDSGMGRIGFRDSQEAQEAIHRLTQAGAQVEGIFTH
FATADEADTHKFEAQLARFKEILGQLETVPPIVHASNSATTLWHADTVMNAVRLGDIIYG
LNPSGRTLQLPYDMKPALSLVSELVHVKQLEAGADVGYGATYTSDSLQYIGTIPLGYADG
WTRDMQGFNVLIDGQPCPIVGRVSMDQITVRLPRSYPIGTPVVLIGESGNEAISATDVAE
KRGTINYEVVCLISDRVPRVYKE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaatattgttacagctagtgttattttggaggaacatcatgaaaacgagtaat
catcgacctactaaggttattgttgatttagctgctatccgctttaatattaaacaaatt
acagcgcatattccagacaatgtagaaaaatgggctgttgtcaaggccgatgcctatggt
cacggtgcagttgctgttacgcaatctattgagtcaattgtggatggtttttgtgtttct
aatattgatgaagctgtagagttgagagaggctggtatttcaaaaaaaattctggtatta
ggagtgtcagatgtttctgccatttcattggcaattgagcgcaaagtgacctgtacggta
gctagtttggaatggctagatttactcttgcaatcaaatatagatgtagctggactgatt
gttcatataaaaattgattctggaatggggcggattggttttcgagatagtcaagaagct
caagaagctattcatcgcttgacgcaagcaggcgctcaggtagaagggattttcacccat
tttgcgacagctgatgaagcagatacgcataaatttgaagcacagctggcacgttttaaa
gaaattttagggcaattagaaaccgttccaccgattgttcacgctagtaattctgcaacg
actctttggcatgcagatactgtgatgaatgcggtgcgtctgggtgatattatctatggt
ctcaatcctagcggtcgtaccttgcagcttccttatgacatgaagccggctctttctcta
gtttcggaattggttcatgtcaagcaattagaagcaggagcagatgtggggtacggagct
acttatacaagtgatagtctacagtatattggaacgattccactgggctatgcagacggt
tggacgcgagatatgcaaggctttaatgttttgattgatggacagccttgtcccattgtt
gggcgcgtgtctatggatcagattactgttcgtttacctcggtcttatcctattggaacg
ccagttgtccttatcggtgaaagtggaaatgaggctatttctgcaacagatgtggcagaa
aaacggggaacaattaactatgaggtggtttgcttaattagtgaccgtgttcctagagtt
tacaaagaatga

DBGET integrated database retrieval system