KEGG   Streptococcus anginosus C1051: SAIN_1582Help
Entry
SAIN_1582         CDS       T02828                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sang  Streptococcus anginosus C1051
Pathway
sang00010  Glycolysis / Gluconeogenesis
sang00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sang00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAIN_1582
   00500 Starch and sucrose metabolism
    SAIN_1582
Enzymes [BR:sang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SAIN_1582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AGU82294
LinkDB All DBs
Position
complement(1658563..1660002)
Genome map
AA seq 479 aa AA seqDB search
MSKFPADFLWGGATAANQYEGAYNVDGKGLSVQDVTPKGGMPAKAGDLNPLITDEPTLDN
LKLEGIDFYHRYKEDIALFAEMGFKVYRTSIAWSRIFPNGDETEPNEAGLKFYDDLFDEL
AKYGIEPLVTLSHYETPLHLARKYNGWANRDLIGFYERYVRTVFTRYKDKVNYWLTFNEI
NSVLHAPFMSGGIATPVEELSKQDLYQAVHHELVASALATKIGHEINPNFKIGCMVLAMP
AYPMTPKPEDVLAAREFENQNYLFSDIHARGKYPAYMNRFFKENGIEIQFAPGDKKLMAE
HTVDFISFSYYMSVVQAHDPESYSSGKGNVLGGLQNPYLASSEWGWQVDPIGLRLVLNAF
YDRYQLPLFIVENGLGAKDVLVDGPDGPTVEDDYRIDYLKRHLQQVGEAIEDGVELWGYT
TWGCIDLVSASTAQMSKRYGFIYVDRNDDGTGTLARYKKKSFDWYKEVIATNGGKLYED
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatttccagcagactttctttggggcggtgcaacagctgccaatcaatacgaa
ggagcttacaatgtggacgggaaaggtctttcggttcaagatgtgacaccaaaaggcggc
atgccagctaaagcaggtgatctcaatcctttgattacagatgagccaacactagacaat
cttaaattagaagggattgacttttatcatcgttacaaagaagacattgccctttttgca
gaaatgggcttcaaggtctatcgtacttccattgcatggtcacggattttcccaaatggt
gatgaaacggagccaaatgaagcaggtctaaagttttatgatgatctctttgatgaattg
gcaaaatatggcattgaacctttagtgactttgtcgcactatgaaacaccgctacacttg
gcacgcaagtacaatggttgggcaaatcgtgatttgattggtttttatgagcgctatgta
cgcactgtctttactcgctacaaagacaaggtgaactattggttgacctttaatgaaatc
aactccgttcttcacgcaccgtttatgagtggagggattgcaacgccagtagaagaattg
tccaagcaagacctttatcaagctgttcatcatgaactagtggcatcagctcttgcaacg
aagattgggcatgaaatcaatccaaactttaagattggttgtatggtactggccatgccg
gcttatccgatgacgccaaaaccagaggacgtactggctgcccgtgagtttgaaaatcaa
aactatctcttttcagatattcatgcgcgtggtaaatacccagcatatatgaatcgtttc
ttcaaggaaaatggaatcgagattcaatttgcgccgggtgataagaaattgatggcagaa
cataccgtggacttcatctccttctcttattatatgagtgtggttcaagctcatgatcca
gaaagttattcttctgggaaaggaaacgttctaggtggtctgcaaaatccttatctggca
agttctgaatggggttggcaagttgacccaattggtctgcgtctggttctcaatgctttc
tatgaccgttaccagttaccgctctttatcgtagaaaatggtcttggtgcgaaagatgtc
ttggtagatggtcctgatggtccgactgttgaagatgattatcgcattgattatcttaaa
cggcatttacagcaggtcggcgaagcaattgaagatggtgttgaactctggggctacacc
acttggggctgtattgaccttgtgtctgcttcaacagctcagatgagcaagcggtacgga
tttatctatgttgatcgaaacgatgatggaacagggactttggctcgctataagaagaaa
tcatttgattggtataaagaagttattgcaacgaatggaggaaaactctatgaagattga

DBGET integrated database retrieval system