KEGG   Streptococcus anginosus C1051: SAIN_1664Help
Entry
SAIN_1664         CDS       T02828                                 

Definition
(GenBank) putative acetyltransferase
  KO
K22477  N-acetylglutamate synthase [EC:2.3.1.1]
Organism
sang  Streptococcus anginosus C1051
Pathway
sang00220  Arginine biosynthesis
sang01100  Metabolic pathways
sang01110  Biosynthesis of secondary metabolites
sang01130  Biosynthesis of antibiotics
sang01210  2-Oxocarboxylic acid metabolism
sang01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sang00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAIN_1664
Enzymes [BR:sang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     SAIN_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_9 FR47 Acetyltransf_3 Acetyltransf_CG PanZ Acetyltransf_4 Acetyltransf_13 Acetyltransf_6 Acetyltransf_15
Motif
Other DBs
NCBI-ProteinID: AGU82370
LinkDB All DBs
Position
complement(1738089..1738529)
Genome map
AA seq 146 aa AA seqDB search
MNIREMAETDYDQVYQLWLSCAGMGLNDLDDSKEGIARFLQRNPQTCLVAVENQTIIGAI
LVGSDGRRAYIYHTAVHPNYRRRGIARQLVETVLTVLDDLKIHKVALVVFKRNAEGNKFW
EKLGFSVREDLIYRNQARTEMVRLDT
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcgtgaaatggcagaaacggattatgatcaggtttatcaattgtggttatca
tgtgcaggcatgggattgaatgatttagatgattcaaaagagggaattgctcggtttttg
cagagaaatcctcaaacttgtctggtggcagtagaaaatcaaacgattatcggagcgatt
ttagttggttcggacggacgaagagcctatatctaccatacagctgttcatccgaactat
cgcaggagagggattgcaagacagctggttgaaacggttttaaccgtcctagatgatttg
aaaattcataaggttgccttggttgtctttaaaaggaatgcagaaggaaacaagttttgg
gagaaattaggattctctgttcgagaagatctcatttaccgcaatcaagcaaggactgaa
atggttcggctggatacctag

DBGET integrated database retrieval system