KEGG   Sinocyclocheilus anshuiensis: 107653435
Entry
107653435         CDS       T04917                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K07827  GTPase KRas
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107653435
   04012 ErbB signaling pathway
    107653435
   04370 VEGF signaling pathway
    107653435
   04371 Apelin signaling pathway
    107653435
   04068 FoxO signaling pathway
    107653435
   04150 mTOR signaling pathway
    107653435
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107653435
   04137 Mitophagy - animal
    107653435
  09143 Cell growth and death
   04210 Apoptosis
    107653435
   04218 Cellular senescence
    107653435
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107653435
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107653435
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107653435
  09152 Endocrine system
   04910 Insulin signaling pathway
    107653435
   04912 GnRH signaling pathway
    107653435
   04914 Progesterone-mediated oocyte maturation
    107653435
   04916 Melanogenesis
    107653435
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107653435
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sanh04031]
    107653435
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    107653435
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107653435
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU FeoB_N MMR_HSR1 G-alpha ATP_bind_1 AAA_14 Septin AAA_25
Other DBs
NCBI-GeneID: 107653435
NCBI-ProteinID: XP_016295640
UniProt: A0A671SGM0
LinkDB
Position
Unknown
AA seq 187 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDVHLYREQINRVKDSDNVPMVLVGNKSDL
ASRTVETRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKHT
QRRCTLL
NT seq 564 nt   +upstreamnt  +downstreamnt
atgacagaatacaagctggtagttgttggggctggtggcgttgggaaaagtgcactgacc
atccagcttattcagaatcactttgtagacgagtatgaccccactattgaggattcttac
agaaagcaggttgtgattgacggagagacgtgtttgctggacatcctggacaccgcaggt
caggaggagtacagtgccatgagagaccagtatatgaggacaggagagggctttctgtgt
gtgtttgccatcaacaacgcaaagtcctttgaggacgtacatctttacagggagcaaata
aaccgtgtcaaagacagtgacaatgtcccgatggtgctggtggggaacaaaagtgacctg
gcctctcgtactgtagagacgcgtcaagcccaagagctcgccagaagttacggggtcccg
tttgtcgaaacatctgccaagacgcgacagggagttgaagaggcattttactctctcgtg
cgggagatccgaagatacaaggagacgaaccgcagcaataagaagagcaaaaagcacaca
cagagacgttgcactcttttatag

KEGG   Sinocyclocheilus anshuiensis: 107653555
Entry
107653555         CDS       T04917                                 

Definition
(RefSeq) ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04218  Cellular senescence
sanh04371  Apelin signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107653555
   04371 Apelin signaling pathway
    107653555
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107653555
   04137 Mitophagy - animal
    107653555
  09143 Cell growth and death
   04218 Cellular senescence
    107653555
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107653555
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107653555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sanh04031]
    107653555
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107653555
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase Septin ATP_bind_1 MMR_HSR1 Gtr1_RagA AAA_16 MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 107653555
NCBI-ProteinID: XP_016295781
UniProt: A0A671S9W0
LinkDB
Position
Unknown
AA seq 208 aa
MATSVVPGDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP
MVLVANKVDLVHLRKITSEQGREMASKHSITYIETSAKDPPMNVDKAFDELVRVIRQQIP
ERGLKKKRKAKWRADRPSGSQRLHCVLL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcgaccagcgtggttcccggggacaacctgcccacatataagctggtggtggtggga
gacggaggcgtggggaagagcgcgctcaccatacagttcttccagaagatcttcgtcccg
gactacgaccccaccatcgaggactcgtacctcaaacacaccgagatcgacggccagtgg
gccattctggacgttctggacacggcggggcaggaggagttcagtgcgatgagagagcag
tacatgaggacaggagacggctttctcatcgtgttttcagtcactgataaagctagtttt
gaacatgtggatcgtttccaccagctgattctgagagtgaaggacagggagtcgtttccc
atggttctggtggctaataaagttgacctggtgcatttacgcaagatcactagtgagcag
ggacgcgagatggcctccaaacacagcatcacgtatattgaaacaagtgcaaaggatcca
cccatgaatgtagacaaagcgtttgacgagctcgtcagagtgatacgtcagcagatccca
gaacgaggcctgaagaagaagaggaaagccaaatggcgggcagacagaccttcgggttcc
cagaggctgcactgcgtcttactgtga

KEGG   Sinocyclocheilus anshuiensis: 107658490
Entry
107658490         CDS       T04917                                 

Definition
(RefSeq) ras-related protein R-Ras-like isoform X1
  KO
K07830  Ras-related protein R-Ras2
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04218  Cellular senescence
sanh04371  Apelin signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107658490
   04371 Apelin signaling pathway
    107658490
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107658490
   04137 Mitophagy - animal
    107658490
  09143 Cell growth and death
   04218 Cellular senescence
    107658490
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107658490
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107658490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107658490
   04031 GTP-binding proteins [BR:sanh04031]
    107658490
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107658490
  Exosomal proteins of bladder cancer cells
   107658490
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107658490
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 Lsr2
Other DBs
NCBI-GeneID: 107658490
NCBI-ProteinID: XP_016302551
LinkDB
Position
Unknown
AA seq 196 aa
MSTEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDILD
TAGQEEFGAMREQYMRSGEGFLLVFALNDSGSYDEIQKFHTQILRVKDRDDFPMVLVGNK
SDLDQQRVISRDEAMSFARENRIHYMESSAKNRHNVDEAFMEVVRAIRKFQETESPPLPA
NHTRKQKSGGCPCTLL
NT seq 591 nt   +upstreamnt  +downstreamnt
atgtcaactgaagaaagatataagttggtggtcgtggggggtggaggtgtggggaaaagc
gccctgactattcagttcattcagtcatactttgtgtcggactatgacccaaccattgaa
gactcgtacactaaaatctgcaccgtggatggaaaggagacacgattagacatcctcgac
acagcagggcaagaagagtttggagcgatgagagagcagtacatgcgctccggagagggt
ttcttactggtgtttgctcttaatgacagtggcagttatgatgaaattcagaaatttcac
actcaaatattgcgggtgaaggatcgagatgactttcctatggttcttgttggcaacaaa
tcagatcttgaccagcagagagttatctcaagagatgaggccatgtcgtttgcccgggaa
aacaggatccactatatggaatcgtcagctaagaaccgccacaatgtggatgaagccttc
atggaggttgtgcgagcaataaggaagtttcaggagacagagagcccaccgctccccgct
aatcacacgaggaagcagaagagtggtggctgtccctgcaccctgctctga

KEGG   Sinocyclocheilus anshuiensis: 107663675
Entry
107663675         CDS       T04917                                 

Definition
(RefSeq) ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04218  Cellular senescence
sanh04371  Apelin signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107663675
   04371 Apelin signaling pathway
    107663675
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107663675
   04137 Mitophagy - animal
    107663675
  09143 Cell growth and death
   04218 Cellular senescence
    107663675
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107663675
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107663675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sanh04031]
    107663675
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107663675
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase ATP_bind_1 Septin MMR_HSR1 Gtr1_RagA AAA_16 MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 107663675
NCBI-ProteinID: XP_016309432
UniProt: A0A671RR72
LinkDB
Position
Unknown
AA seq 208 aa
MATSVVPGDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP
MVLVANKVDLVHLRKITSEQGREMASKHSITYIETSAKDPPMNVDKAFHELVRVIRQQIP
ERGLKKKRKAKWRADRPSGSQRLHCVLL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcgaccagcgtggttcccggggacaacctgcccacgtataagctggtggtggtggga
gacggcggcgtggggaagagcgcgctcaccatacagttcttccagaagatcttcgtcccg
gactacgaccccaccatcgaggactcgtacctcaaacacaccgagatcgacggccagtgg
gccattctggacgttctggacacggcggggcaggaggagttcagtgcgatgagagagcag
tacatgaggacaggagacggctttctcatcgtgttttcagtcactgataaagccagcttt
gaacacgtggatcgtttccaccagctgattctgagagtgaaggaccgggagtcgtttccc
atggttctggtggctaataaagttgatctggtgcatttacgcaagatcaccagtgagcag
ggacgagagatggcctccaaacacagcatcacgtatattgaaacgagtgcaaaggatccg
cccatgaatgtagacaaagcgtttcacgagcttgtcagagtgatacgtcagcagatccca
gaacggggcctgaagaagaagaggaaagccaaatggcgggcggacagaccttcaggttcc
cagaggctgcactgcgtcttactgtga

KEGG   Sinocyclocheilus anshuiensis: 107663912
Entry
107663912         CDS       T04917                                 

Definition
(RefSeq) ras-related protein M-Ras isoform X1
  KO
K07831  Ras-related protein M-Ras
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04218  Cellular senescence
sanh04371  Apelin signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107663912
   04371 Apelin signaling pathway
    107663912
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107663912
   04137 Mitophagy - animal
    107663912
  09143 Cell growth and death
   04218 Cellular senescence
    107663912
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107663912
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107663912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sanh04031]
    107663912
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107663912
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase Septin MMR_HSR1 ATP_bind_1 AAA_16
Other DBs
NCBI-GeneID: 107663912
NCBI-ProteinID: XP_016309797
LinkDB
Position
Unknown
AA seq 215 aa
MTGVAVIMATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKH
TEIDDQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHIDRFHQLILRV
KDRESFPMVLVANKVDLVHLRKVTNEQGCEMAAKHNITYIETSAKDPPMNVDRAFHELVR
VIRQQVPERSLKKKKKTKWRGDRAMSSHKLHCVIL
NT seq 648 nt   +upstreamnt  +downstreamnt
atgactggtgtagctgttatcatggcaaccagtgcggtccctagcgacaacctcccaacg
tataaattggtggttgtgggagatggaggcgtgggaaagagtgctcttaccatccagttt
ttccaaaagatttttgtgccagattacgatcctactatagaagactcctacttgaaacac
acagagatcgatgaccagtgggctattttggatgttttagacacagcaggtcaagaggaa
ttcagcgccatgcgagagcagtacatgaggactggagatggtttcctcattgtgttctct
gtgacggacaaggccagttttgaacacatcgaccgctttcaccagctcatcctacgagtc
aaagaccgggaatctttccctatggttttggtggctaacaaagtggacctggtgcatctg
aggaaagtgacaaatgaacagggctgtgagatggcagccaaacacaacattacttacatt
gaaacaagtgccaaggatcctccaatgaatgtggacagagcctttcatgaattagtcaga
gttatcagacagcaagttccagagcggagtctgaaaaagaagaaaaagacaaagtggcgt
ggagacagagccatgagttctcacaagcttcactgtgtgatattgtga

KEGG   Sinocyclocheilus anshuiensis: 107664995
Entry
107664995         CDS       T04917                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K07828  GTPase NRas
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107664995
   04012 ErbB signaling pathway
    107664995
   04370 VEGF signaling pathway
    107664995
   04371 Apelin signaling pathway
    107664995
   04068 FoxO signaling pathway
    107664995
   04150 mTOR signaling pathway
    107664995
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107664995
   04137 Mitophagy - animal
    107664995
  09143 Cell growth and death
   04210 Apoptosis
    107664995
   04218 Cellular senescence
    107664995
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107664995
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107664995
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107664995
  09152 Endocrine system
   04910 Insulin signaling pathway
    107664995
   04912 GnRH signaling pathway
    107664995
   04916 Melanogenesis
    107664995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107664995
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107664995
   04031 GTP-binding proteins [BR:sanh04031]
    107664995
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    107664995
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107664995
  Exosomal proteins of other body fluids (saliva and urine)
   107664995
  Exosomal proteins of breast cancer cells
   107664995
  Exosomal proteins of colorectal cancer cells
   107664995
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107664995
SSDB
Motif
Pfam: Ras Roc MMR_HSR1 Arf Septin GTP_EFTU PglD_N AAA_16 RsgA_GTPase VirE AAA_14 AIG1 AAA_25 Ldh_1_N ParA
Other DBs
NCBI-GeneID: 107664995
NCBI-ProteinID: XP_016311191
UniProt: A0A671PPH7
LinkDB
Position
Unknown
AA seq 100 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNLKSFADVHLYRSVS
NT seq 303 nt   +upstreamnt  +downstreamnt
atgacggagtataagttggttgttgtgggagcaggtggtgttgggaagagtgctttaacc
atccagctcattcaaaatcactttgtggatgaatatgaccctactattgaggactcttac
aggaagcaggtggtgattgacggtgagacgtgtctgctggacatcctggacactgcaggg
caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt
gtctttgccataaacaacctcaaatccttcgccgatgtgcatttgtacaggtccgtaagc
tga

KEGG   Sinocyclocheilus anshuiensis: 107674363
Entry
107674363         CDS       T04917                                 

Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107674363
   04012 ErbB signaling pathway
    107674363
   04370 VEGF signaling pathway
    107674363
   04371 Apelin signaling pathway
    107674363
   04068 FoxO signaling pathway
    107674363
   04150 mTOR signaling pathway
    107674363
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107674363
   04137 Mitophagy - animal
    107674363
  09143 Cell growth and death
   04210 Apoptosis
    107674363
   04218 Cellular senescence
    107674363
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107674363
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107674363
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107674363
  09152 Endocrine system
   04910 Insulin signaling pathway
    107674363
   04912 GnRH signaling pathway
    107674363
   04916 Melanogenesis
    107674363
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107674363
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107674363
   04031 GTP-binding proteins [BR:sanh04031]
    107674363
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    107674363
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107674363
  Exosomal proteins of other body fluids (saliva and urine)
   107674363
  Exosomal proteins of breast cancer cells
   107674363
  Exosomal proteins of colorectal cancer cells
   107674363
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107674363
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin VirE Ldh_1_N
Other DBs
NCBI-GeneID: 107674363
NCBI-ProteinID: XP_016323803
UniProt: A0A671N0H5
LinkDB
Position
Unknown
AA seq 188 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL
ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC
LGVSCEVM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaccgagtataagttggttgttgtgggagcaggtggtgttgggaagagtgctttaacc
atccagctcattcagaatcactttgtggatgaatatgaccctactattgaggactcttac
aggaagcaggtggtgattgacggtgagacttgtctgctggatatcctggacactgcaggt
caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt
gtctttgccataaacaacagcaaatccttcgccgatgtgcatttgtacagagaacagatc
aagcgcgtgaaggactccgatgatgttcccatggtcctagtggggaacaagtgtgatttg
gccagaacggtggacaccaagcaagctcaggaacttgccagaagctacggcatagagttt
gtagaaacttctgccaagaccagacagggagttgaggatgctttttacacccttgtccgt
gagatccgacattatcgcatgaaaaagctcaacagtagagaagacaggaagcagggctgt
ctgggtgtgtcctgtgaagtcatgtga

KEGG   Sinocyclocheilus anshuiensis: 107675271
Entry
107675271         CDS       T04917                                 

Definition
(RefSeq) ras-like protein isoform X1
  KO
K07827  GTPase KRas
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107675271
   04012 ErbB signaling pathway
    107675271
   04370 VEGF signaling pathway
    107675271
   04371 Apelin signaling pathway
    107675271
   04068 FoxO signaling pathway
    107675271
   04150 mTOR signaling pathway
    107675271
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107675271
   04137 Mitophagy - animal
    107675271
  09143 Cell growth and death
   04210 Apoptosis
    107675271
   04218 Cellular senescence
    107675271
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107675271
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107675271
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107675271
  09152 Endocrine system
   04910 Insulin signaling pathway
    107675271
   04912 GnRH signaling pathway
    107675271
   04914 Progesterone-mediated oocyte maturation
    107675271
   04916 Melanogenesis
    107675271
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107675271
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sanh04031]
    107675271
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    107675271
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107675271
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin AAA_25 CbiA
Other DBs
NCBI-GeneID: 107675271
NCBI-ProteinID: XP_016325048
UniProt: A0A671QUZ9
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRSVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLRKLSKEEKTTQC
IKLKKCVLM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacagaatataagcttgtggtggtgggcgctggaggcgtgggcaagagcgctctcacc
atccaactcatccagaaccactttgtggatgaatacgacccaactatagaggactcctac
aggaagcaggtggtgattgacggggagacgtgtctgctggacatcttggacactgcaggt
caggaggagtacagcgccatgagggatcagtacatgaggacaggagagggcttcctctgt
gtctttgccatcaataacaccaagtcctttgaggacattcaccactacagagagcagata
aagcgagtaaaggactctgaggacgtccccatggtcctggtggggaataagtgtgatctt
ccttcccgcagtgtggacacaaagcaggctcaggatttagcacgtagctacggcatccca
tttatagagacctcagcaaagacgagacagagagtggaagatgccttttatactctggta
cgggagatcaggcaataccggctgagaaaactcagtaaagaagaaaagacgacacaatgc
atcaagcttaaaaaatgtgttttgatgtga

KEGG   Sinocyclocheilus anshuiensis: 107675296
Entry
107675296         CDS       T04917                                 

Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04144  Endocytosis
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107675296
   04012 ErbB signaling pathway
    107675296
   04370 VEGF signaling pathway
    107675296
   04371 Apelin signaling pathway
    107675296
   04068 FoxO signaling pathway
    107675296
   04150 mTOR signaling pathway
    107675296
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107675296
   04140 Autophagy - animal
    107675296
   04137 Mitophagy - animal
    107675296
  09143 Cell growth and death
   04210 Apoptosis
    107675296
   04218 Cellular senescence
    107675296
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107675296
   04540 Gap junction
    107675296
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107675296
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107675296
  09152 Endocrine system
   04910 Insulin signaling pathway
    107675296
   04912 GnRH signaling pathway
    107675296
   04916 Melanogenesis
    107675296
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107675296
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107675296
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107675296
   04031 GTP-binding proteins [BR:sanh04031]
    107675296
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    107675296
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107675296
  Exosomal proteins of colorectal cancer cells
   107675296
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107675296
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Gtr1_RagA Septin FeoB_N ATP_bind_1 CbiA AAA_25 ParA AAA_16 PglD_N
Other DBs
NCBI-GeneID: 107675296
NCBI-ProteinID: XP_016325082
LinkDB
Position
Unknown
AA seq 158 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTRQAQELARSYGIPFIETSAKTRQVSQFLTGI
NT seq 477 nt   +upstreamnt  +downstreamnt
atgactgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc
atccaactcatccagaaccactttgtggatgaatacgaccccactatagaggactcctac
aggaagcaggtggtgattgacggggagacgtgtctcctggacatcttggacactgcaggt
caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt
gtgtttgccatcaataacaccaagtcctttgaggacattcatcagtacagggaacagatc
aaacgggtgaaggactcggatgacgtgcccatggtgctggtgggtaacaagtgcgacctc
ccggcccggacggtggacacacggcaagcgcaggagctcgcgcgcagctacgggatcccc
ttcatcgagacctcagccaaaacacgacaggtcagtcagtttctgacaggcatttaa

KEGG   Sinocyclocheilus anshuiensis: 107675456
Entry
107675456         CDS       T04917                                 

Definition
(RefSeq) ras-like protein isoform X1
  KO
K07827  GTPase KRas
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107675456
   04012 ErbB signaling pathway
    107675456
   04370 VEGF signaling pathway
    107675456
   04371 Apelin signaling pathway
    107675456
   04068 FoxO signaling pathway
    107675456
   04150 mTOR signaling pathway
    107675456
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107675456
   04137 Mitophagy - animal
    107675456
  09143 Cell growth and death
   04210 Apoptosis
    107675456
   04218 Cellular senescence
    107675456
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107675456
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107675456
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107675456
  09152 Endocrine system
   04910 Insulin signaling pathway
    107675456
   04912 GnRH signaling pathway
    107675456
   04914 Progesterone-mediated oocyte maturation
    107675456
   04916 Melanogenesis
    107675456
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107675456
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sanh04031]
    107675456
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    107675456
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107675456
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin AAA_25 CbiA
Other DBs
NCBI-GeneID: 107675456
NCBI-ProteinID: XP_016325293
UniProt: A0A671KB23
LinkDB
Position
Unknown
AA seq 189 aa
MAEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRSVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLRKLSKEEKTTQC
IKLKKCVLM
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc
atccaactcatccagaaccactttgtggatgaatacgacccaaccatagaggactcctac
agaaagcaggtggtgattgacggggagacgtgtctgctggacatcttggacactgcaggt
caggaggagtacagcgccatgagggatcagtacatgaggacaggagagggcttcctttgt
gtcttcgccatcaataacaccaagtcctttgaggacattcaccactacagagagcagata
aaacgagtaaaggactctgaggacgtccccatggtcctggtggggaataagtgtgatctt
ccatcccgcagtgtggacaccaagcaggctcaggatttagcacgtagctacggcatccca
tttatagagacctcagcaaagactagacagagagtggaagatgccttttatactctggta
cgggaaatcaggcaataccggctgagaaaactcagtaaagaagaaaagacgacacaatgc
atcaagcttaaaaaatgtgttttgatgtga

KEGG   Sinocyclocheilus anshuiensis: 107675668
Entry
107675668         CDS       T04917                                 

Definition
(RefSeq) GTPase HRas-like isoform X1
  KO
K02833  GTPase HRas
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04144  Endocytosis
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107675668
   04012 ErbB signaling pathway
    107675668
   04370 VEGF signaling pathway
    107675668
   04371 Apelin signaling pathway
    107675668
   04068 FoxO signaling pathway
    107675668
   04150 mTOR signaling pathway
    107675668
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107675668
   04140 Autophagy - animal
    107675668
   04137 Mitophagy - animal
    107675668
  09143 Cell growth and death
   04210 Apoptosis
    107675668
   04218 Cellular senescence
    107675668
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107675668
   04540 Gap junction
    107675668
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107675668
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107675668
  09152 Endocrine system
   04910 Insulin signaling pathway
    107675668
   04912 GnRH signaling pathway
    107675668
   04916 Melanogenesis
    107675668
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107675668
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107675668
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107675668
   04031 GTP-binding proteins [BR:sanh04031]
    107675668
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    107675668
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107675668
  Exosomal proteins of colorectal cancer cells
   107675668
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107675668
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin ATP_bind_1 AAA_25 CbiA
Other DBs
NCBI-GeneID: 107675668
NCBI-ProteinID: XP_016325572
UniProt: A0A671NME2
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc
atccaactcatccagaaccactttgtggatgaatacgaccccactatagaggactcctac
aggaagcaggtggtgattgacggggagacgtgtctcctggacatcttggacactgcaggt
caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt
gtgtttgccatcaataacaccaagtcctttgaggacattcatcagtacagggaacagatc
aaacgggtgaaggactcggatgatgtgcccatggtgctggtgggtaacaaatgtgacctc
ccggcccggacggtggacacgcgacaagctcaggagctcgcgcgcagctacgggatcccc
ttcatcgagacctcggccaaaacacgacaaggtgtggaggatgcgttttacacgctggtg
cgagagatccgtcagcacaagatgaggaagctgaacccgccggacgagagcggacaggac
tgcatgagctgccgctgtgtcgtgtcgtga

KEGG   Sinocyclocheilus anshuiensis: 107688170
Entry
107688170         CDS       T04917                                 

Definition
(RefSeq) ras-related protein R-Ras2-like
  KO
K07830  Ras-related protein R-Ras2
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04218  Cellular senescence
sanh04371  Apelin signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107688170
   04371 Apelin signaling pathway
    107688170
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107688170
   04137 Mitophagy - animal
    107688170
  09143 Cell growth and death
   04218 Cellular senescence
    107688170
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107688170
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107688170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107688170
   04031 GTP-binding proteins [BR:sanh04031]
    107688170
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107688170
  Exosomal proteins of bladder cancer cells
   107688170
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107688170
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 DUF2075
Other DBs
NCBI-GeneID: 107688170
NCBI-ProteinID: XP_016341249
UniProt: A0A671K253
LinkDB
Position
Unknown
AA seq 202 aa
MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA
RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM
ILVGNKADLEQQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVSYIAVFQEQE
CPPSPEPTRKEKDKSGCHCVIV
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctggctggaaggacggctcagtgcaggagaaatatcgcctggtggtcgttggaggt
ggaggcgtcggaaaatcagcattaaccatccagtttatccagtcatacttcgtcactgac
tatgaccctacgattgaagactcctacacaaagcagtgtgtgattgacgagaggcctgca
cggctggacatcctggatacagcaggacaggaagagtttggagccatgagagaacaatac
atgaggacaggggagggcttccttcttgtcttctctgtcactgaccggggaagctttgaa
gagatctacaagttccaacgacagattttgagagtgaaggaccgggatgaatttcccatg
attctagtgggtaacaaagctgatcttgagcaacagagacaagtgacccaggaggagggt
cagcagctcgcccgacaactcaaagtcacatacatggaggcctcagctaagatccgtatg
aatgtagaccaggctttccatgagctggtgtcatacattgctgttttccaggagcaagag
tgcccaccctcgccggagcccacgcgcaaagagaaggataagagcggctgccattgtgtg
attgtctaa

KEGG   Sinocyclocheilus anshuiensis: 107689668
Entry
107689668         CDS       T04917                                 

Definition
(RefSeq) ras-related protein R-Ras-like
  KO
K07830  Ras-related protein R-Ras2
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04218  Cellular senescence
sanh04371  Apelin signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107689668
   04371 Apelin signaling pathway
    107689668
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107689668
   04137 Mitophagy - animal
    107689668
  09143 Cell growth and death
   04218 Cellular senescence
    107689668
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107689668
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107689668
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107689668
   04031 GTP-binding proteins [BR:sanh04031]
    107689668
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107689668
  Exosomal proteins of bladder cancer cells
   107689668
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107689668
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1
Other DBs
NCBI-GeneID: 107689668
NCBI-ProteinID: XP_016343269
UniProt: A0A671PFJ2
LinkDB
Position
Unknown
AA seq 197 aa
MMSTEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL
DTAGQEEFGAMREQYMRSGEGFLLVFALNDSGSYDEIQKFHTQILRVKDQDDFPMVLVGN
KSDLDQLRVISRDEAMSFARENRIHYMESSAKNRHNVDEAFVEVVRAIRKFQETESPPLP
ANHARKQKSGGCPCTLL
NT seq 594 nt   +upstreamnt  +downstreamnt
atgatgtcaactgaagaaagatataagttggtggtcgtgggcggtggaggtgtggggaaa
agcgccctcaccattcagttcattcagtcgtactttgtgtcggactatgacccaaccatt
gaagactcgtacactaaaatatgcactgtggatggaaaggagacacgattagacatcctc
gacacagcaggacaagaagagtttggagcgatgagagagcagtacatgcgctccggagag
ggtttcttattggtgtttgctcttaatgacagtggcagttatgatgaaattcagaaattt
cacactcagatattgcgggtgaaggatcaagatgattttcctatggttcttgttggcaac
aaatcagatcttgaccagctgagagtgatctcaagagatgaggccatgtcatttgcccga
gaaaacaggatccactatatggaatcgtcagctaagaaccgccacaatgtggatgaagcc
ttcgtggaggttgtgcgagcaataaggaagtttcaggagacagaaagtccaccgctcccc
gctaatcatgcgaggaagcagaagagtggtggctgtccctgcaccctgctctga

KEGG   Sinocyclocheilus anshuiensis: 107695370
Entry
107695370         CDS       T04917                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04144  Endocytosis
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107695370
   04012 ErbB signaling pathway
    107695370
   04370 VEGF signaling pathway
    107695370
   04371 Apelin signaling pathway
    107695370
   04068 FoxO signaling pathway
    107695370
   04150 mTOR signaling pathway
    107695370
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107695370
   04140 Autophagy - animal
    107695370
   04137 Mitophagy - animal
    107695370
  09143 Cell growth and death
   04210 Apoptosis
    107695370
   04218 Cellular senescence
    107695370
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107695370
   04540 Gap junction
    107695370
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107695370
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107695370
  09152 Endocrine system
   04910 Insulin signaling pathway
    107695370
   04912 GnRH signaling pathway
    107695370
   04916 Melanogenesis
    107695370
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107695370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107695370
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107695370
   04031 GTP-binding proteins [BR:sanh04031]
    107695370
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    107695370
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107695370
  Exosomal proteins of colorectal cancer cells
   107695370
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107695370
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA Septin ATP_bind_1
Other DBs
NCBI-GeneID: 107695370
NCBI-ProteinID: XP_016350741
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTRQAQELACSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQG
CMNCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggaatataagttagtggtggttggtgcaggtggtgtgggcaagagtgctctgaca
atccagctcattcagaaccactttgttgatgaatacgacccaaccattgaggactcatat
aggaaacaggtggtgattgatggagagacgtgtctgttggatatcctggatactgcaggt
caggaagagtacagtgcaatgagagaccagtacatgaggaccggagagggctttctctgt
gtctttgccatcaacaataccaagtcttttgaggacattcatcagtacagggaacagatt
aagagggttaaagactcagatgatgtgccgatggtgcttgtgggtaataaatgtgactta
ccagcgcgcactgtggacacaagacaagcccaggaactcgcctgtagctatggtataccc
tacattgaaacctcagccaagacaagacagggagtggaagatgccttttacactcttgtc
cgtgaaatcaggcagcataagctgaggaaactgaacccgccagatgacaatggccaaggc
tgtatgaactgccgctgtgtggtgtcatga

KEGG   Sinocyclocheilus anshuiensis: 107696631
Entry
107696631         CDS       T04917                                 

Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04144  Endocytosis
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107696631
   04012 ErbB signaling pathway
    107696631
   04370 VEGF signaling pathway
    107696631
   04371 Apelin signaling pathway
    107696631
   04068 FoxO signaling pathway
    107696631
   04150 mTOR signaling pathway
    107696631
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107696631
   04140 Autophagy - animal
    107696631
   04137 Mitophagy - animal
    107696631
  09143 Cell growth and death
   04210 Apoptosis
    107696631
   04218 Cellular senescence
    107696631
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107696631
   04540 Gap junction
    107696631
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107696631
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107696631
  09152 Endocrine system
   04910 Insulin signaling pathway
    107696631
   04912 GnRH signaling pathway
    107696631
   04916 Melanogenesis
    107696631
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107696631
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107696631
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107696631
   04031 GTP-binding proteins [BR:sanh04031]
    107696631
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    107696631
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107696631
  Exosomal proteins of colorectal cancer cells
   107696631
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107696631
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin ATP_bind_1 AAA_25
Other DBs
NCBI-GeneID: 107696631
NCBI-ProteinID: XP_016352557
UniProt: A0A671P282
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQG
CMNCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggaatataagttagtggtggttggtgcaggtggcgtgggcaagagcgctctgacc
atccagctcattcagaaccactttgttgatgaatacgacccaaccattgaggactcatat
aggaaacaggtggtgattgatggagagacgtgtctgttggatatcctggatactgcaggt
caggaagagtacagtgcaatgagagaccaatacatgaggactggagagggttttctctgt
gtctttgccatcaacaatactaagtcttttgaggacattcatcagtacagggaacagatt
aagagggttaaagactcagatgatgtgcccatggtgcttgtgggtaataaatgtgactta
ccagcacgcactgtggacacaagacaagcccaggaactcgcccgcagctacggtattccc
tacatcgaaacctcagccaagacaagacagggagtggaagatgccttttacactcttgtt
cgtgaaatcaggcagcataagctgaggaaacttaacccgccagatgacaatggtcaaggc
tgtatgaactgccgctgtgtggtgtcatga

KEGG   Sinocyclocheilus anshuiensis: 107700214
Entry
107700214         CDS       T04917                                 

Definition
(RefSeq) ras-related protein M-Ras
  KO
K07831  Ras-related protein M-Ras
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04218  Cellular senescence
sanh04371  Apelin signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107700214
   04371 Apelin signaling pathway
    107700214
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107700214
   04137 Mitophagy - animal
    107700214
  09143 Cell growth and death
   04218 Cellular senescence
    107700214
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107700214
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107700214
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sanh04031]
    107700214
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107700214
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 Gtr1_RagA AAA_16 Polysacc_lyase
Other DBs
NCBI-GeneID: 107700214
NCBI-ProteinID: XP_016357280
UniProt: A0A671KMN0
LinkDB
Position
Unknown
AA seq 208 aa
MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP
MVLVANKVDLVHLRKVTNEQGCEMAAKHNITYIETSAKDPPMNVDRAFHELVRVIRQQVP
ERSLKKKKKTKWRGDRAMSSHKLHCVIL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcaaccagtgcggtccctagcgacaacctcccaacatacaaattggtggttgtggga
gatggaggcgtgggaaagagtgctcttacaattcagtttttccaaaagatttttgtgcca
gattatgatcctactattgaagactcctacttgaaacacacagagatcgatggccagtgg
gctattttggatgttttagacacagcaggtcaagaggaattcagcgccatgcgagagcag
tacatgaggactggtgacggtttcctcattgtgttctctgtgacggacaaggccagtttt
gaacacgtcgatcggtttcaccagcttatcctacgagtgaaagaccgggaatctttcccc
atggttttggtggctaacaaagtggacctagtgcatctgaggaaagtgacaaatgaacag
ggctgtgagatggctgccaaacacaatattacttacattgaaacaagtgccaaggatcct
ccgatgaatgtggacagagcctttcatgaactagtcagagttatcagacagcaagttcca
gaacggagtctgaaaaagaagaaaaagacaaagtggcgtggagacagagccatgagttct
cacaagcttcactgtgtgatattgtga

KEGG   Sinocyclocheilus anshuiensis: 107700612
Entry
107700612         CDS       T04917                                 

Definition
(RefSeq) ras-related protein R-Ras2
  KO
K07830  Ras-related protein R-Ras2
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04218  Cellular senescence
sanh04371  Apelin signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107700612
   04371 Apelin signaling pathway
    107700612
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107700612
   04137 Mitophagy - animal
    107700612
  09143 Cell growth and death
   04218 Cellular senescence
    107700612
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107700612
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107700612
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107700612
   04031 GTP-binding proteins [BR:sanh04031]
    107700612
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107700612
  Exosomal proteins of bladder cancer cells
   107700612
GTP-binding proteins [BR:sanh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107700612
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 DUF2075
Other DBs
NCBI-GeneID: 107700612
NCBI-ProteinID: XP_016357830
UniProt: A0A671SPB9
LinkDB
Position
Unknown
AA seq 202 aa
MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA
RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM
ILVGNKADLEQQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE
CPPSPEPTRKEKDKSGCHCVIV
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctggctggaaggacggctcagtgcaggagaaatatcgcctggtggtcgtcggaggt
ggtggcgtcggaaaatcagcattaaccattcagtttatccagtcatacttcgtcactgac
tatgaccctacgattgaagactcctacacaaagcagtgtgtgattgacgagaggcctgcg
cggctagacatcctggatacagcaggacaggaagagtttggagccatgagagaacaatac
atgaggacaggggagggcttccttctcgtcttctctgtcactgaccggggaagctttgaa
gagatctacaagttccaacgacagatcttgagagtgaaggaccgggatgaatttcccatg
attctagtgggtaacaaagctgatcttgagcaacagagacaagtgacccaggaggagggc
cagcagctcgcccgacaactcaaagtcacatacatggaggcctcagctaagatccgtatg
aatgtagaccaggctttccacgagctggtccgagtcataaggaagttccaggagcaagag
tgcccaccctcaccggagcccacacgcaaagagaaggataagagtggctgccattgtgtg
attgtctaa

DBGET integrated database retrieval system