KEGG   Sinocyclocheilus anshuiensis: 107653924Help
Entry
107653924         CDS       T04917                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sanh01002]
    107653924
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107653924
   04090 CD molecules [BR:sanh04090]
    107653924
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     107653924
Peptidases [BR:sanh01002]
 Metallo Peptidases
  Family M2
   107653924
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107653924
CD molecules [BR:sanh04090]
 Proteins
  107653924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 FixQ Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 107653924
NCBI-ProteinID: XP_016296271
LinkDB All DBs
Position
Unknown
AA seq 1329 aa AA seqDB search
MQDDGQTASVLTDVLPVSGQEHPAVSVSSRLLGELSFLHFSFLTSQLWSIMYRAVVLLTL
ISTSAALKPEWIPGDYSMTEAGAESFVSDYNSTAEEVFYFSTEASWNYNTNLTDHNSQLQ
VSASLEEQAFTEAWGQKAKATFSDSLMESFTNPDLKKLISKINVLGPANLPTTERERYNT
ILSQMDSIYSKAKVCPPSEECWSLEPELTEIMATSRSYKRLLYVWEGWHNASGVPLRSLY
PEFVELSNKASRMDGFDDTGAYWLSWYESQTFKQDLENLFKQLEPLYQNLHAFVRRKLYD
YYGPKYINLKGPIPAHLLGNMWSQMWNNIYNLMIPFPDKPNVDVMDTMVAKGYNATHMFR
VAEEFFTSLGLLEMPPEFWDKAMLEKPTNGRDVVCHASAWDFYNRKDFRIKQCTTVTMEQ
LFTVHHEMGHVEYYLQYKEQPVSFRRGANPGFHEAVGDVLSLSVSTPKHLHTIGLLDQLT
DDAESDINYLLKMALEKIAFLPFGYLIDQWRWGVFSGRTPPERYNAEWWYLRTKYQGICP
PTRRTEEHFDAGAKYHIPGNTPYIRYFVSFILQFQFHQKLCQAAGHTGPLHKCDIYRSRE
AGAVLEKVLKAGSSKPWTEVLQEALGTDKMDASPLMSYFEPVTTWLQEQNAKTGEMLGWP
DFNWVPPVPEGYPEDIGKITDEMLAKQFLEQYNSTAEEVWNAYTEASWTYNTDITEANKE
IMLQKNLEMANHTKIYGLEARKFDTSDFQDESVKRILTKLSDLERAALSEHDLIEYNNLL
ASMETLYSVATVCKDQSTCLPLDPVLNKIMAESRDYDELLFAWQGWRNASGRELRSSYKR
YVELANLAAKSNSHTDNGAFWRSLYETPTFEEDLEALWKDLEPLYLNVHAYVRRALYKKY
GPERINLKGPIPAHLLGNMWAQTWSAIMDLVIPYPDATQVDATPAMIAQGWDPKRMFQES
DRFFTSIGLLPMPPEFWNKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTVVTMDDLI
TVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVLALSISTPKHLQSIGLLVKVEDN
KESTINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRISSSEYNKEWWNLRMKYQGLCPPV
PRTEEDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCEAAGQPAPLHNCDIYQSKEAG
KLLGDVMKMGFSKPWPEAMTLITGQPKMSVQPLMEYFQPLIEWLEEENKKNGDVLGWPEY
DWTPYKMMEEKPKAVSFLGLSVDEAGAVAGQWILLVLSIVFLLGIIYLVYRYGKTKRLQD
KSMSQMELK
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgatgggcaaacagcgtctgtgctgacagatgtgctgcctgtctcaggacag
gagcatccagcagtgagtgtgtcaagtcggctcctcggggaactttcattcctgcacttt
tccttcctcacgtcgcagctgtggtccattatgtaccgggcagtggtgctgctgactctc
atcagcacgagcgcagctctgaaacccgagtggatcccgggggattattctatgacagag
gcaggggctgagagcttcgtgagcgactacaactcaaccgccgaggaggtcttctacttc
agcacagaggccagctggaactacaacaccaacctgacagatcacaattcgcagctgcag
gtttctgcgtctttggaggagcaggctttcacagaggcatggggtcaaaaagcaaaggct
accttcagtgattctctcatggagagcttcactaatccagacctgaagaaactcatcagt
aagatcaatgttctgggacctgccaatctcccaaccacagagagagagcggtacaacacc
attctgagccagatggacagcatctactcaaaggcaaaggtgtgtcccccttcagaggaa
tgctggtctttggagcctgagctcacagaaataatggctacctcaagaagctataagagg
cttctgtatgtctgggaaggctggcacaatgcctcaggggtcccactcagatccctctac
cctgagtttgtggagctcagcaacaaggcatctcgaatggacggctttgacgatacaggc
gcttactggctttcctggtacgaatctcagaccttcaagcaagacctagagaatctgttt
aaacagctggaacctctctaccaaaacctgcatgcctttgttcgccgaaagctctacgac
tactatggtcctaaatacatcaacctcaagggtcccatccctgcccacctcttgggcaat
atgtggtcacaaatgtggaacaacatctacaacctgatgatcccttttcctgacaagccc
aatgtagatgtgatggacaccatggttgctaaaggttataatgctactcacatgttccgg
gtggctgaggagttcttcacctctctgggtttgctcgaaatgcctcctgagttttgggac
aaggccatgctggagaaacccaccaacggaagggatgtggtctgccatgcctctgcctgg
gacttctacaaccgcaaagacttcagaatcaaacagtgtaccactgtcactatggagcag
cttttcaccgtgcatcacgagatgggccatgtggaatattacctccagtacaaagagcag
ccggtcagcttcaggagaggagccaatcctggcttccatgaggccgtaggagatgtgctg
tctctgtctgtgtccacacccaaacatctccacaccatcggtctcctggaccaactgacc
gatgatgctgagagtgacatcaactacctgttgaagatggctttggaaaagatcgccttc
cttccttttggatatcttattgatcagtggcgctggggtgtgtttagtggacgaacaccg
cctgaacgttataatgcagaatggtggtacctcaggacaaaataccaaggcatctgtcca
ccaaccagacgtacagaggagcattttgatgctggagcgaaatatcacattcctggaaac
acaccgtacatcagatactttgtgagcttcattctgcagttccagttccatcagaaatta
tgtcaggctgctggacataccggacctctgcacaaatgcgatatctacagatcaagagag
gctggagctgttttagagaaagtcttgaaggctggttcttcaaagccttggacagaagtg
ctacaagaggctctgggcactgacaaaatggacgccagccccctgatgagctattttgag
ccagttactacctggctgcaggaacagaatgcgaaaacaggagagatgctgggctggcct
gattttaattgggtgccaccagtaccagaaggctaccctgaagacatcggtaaaataaca
gatgagatgctggccaagcagttcttggagcaatacaacagcacagcggaggaggtctgg
aatgcgtacactgaggcctcctggacctacaacactgacatcactgaagccaacaaggag
atcatgctgcaaaaaaacttggagatggccaaccacacaaagatctatggactagaggcc
cgtaagttcgacaccagcgacttccaggacgagtcggtgaaaagaatcctgaccaaactg
agtgaccttgagagagctgcactttctgaacatgatcttatagagtacaataatttgcta
gcatccatggagaccctgtacagtgtagccacagtctgcaaggatcaatcaacttgtctg
cctctagatccagttctgaataagatcatggccgagtccagggattatgacgagctgctg
ttcgcctggcagggttggcgtaatgcctcgggcagagagctccgcagcagctacaagaga
tatgtggagcttgccaatttagctgcaaagagcaatagtcacacggataatggggcattc
tggcgttctctgtatgagacccccacctttgaagaggatctggaagccttgtggaaagat
ctagaaccgctctacctcaacgttcatgcttatgtgcgcagggcactgtacaagaaatac
ggaccagaacgaatcaaccttaaaggaccaattccagctcatctactcggaaatatgtgg
gcccaaacgtggtctgctatcatggaccttgtcattccataccctgatgccacacaagtg
gatgccacgccagccatgattgctcaaggttgggaccccaagcggatgttccaggaatcg
gaccggttcttcacttctataggtcttctgcccatgcctcctgagttctggaacaagtcc
atgctggaaaagccaacagatggacgtgaagtggtctgccatgcttctgcttgggacttc
tacaaccgcaaagacttcaggatcaagcagtgcacggtggtgaccatggacgacctcatc
accgtgcaccacgagatgggccacgttcaatacttcctgcagtataaggatcaacccatc
tctttccgcgatggcgccaaccctggattccacgaggccatcggtgatgtactggccctg
tccatttccacacctaaacatctccagagcattggcctgctggtcaaggtggaggacaat
aaagaaagcaccatcaacttcctgatgagcatggccttggataagattgccttcctgcct
tttggttacctaatggaccagtggaggtggaaggtgtttgatggaaggatctcaagctca
gagtacaacaaagagtggtggaacctgagaatgaagtaccagggattgtgtccacctgta
ccgcgcactgaggaagacttcgaccctggtgcaaagttccacatcccagctaatgtgccc
tacgtcaggtactttgtgagttttataatccagttccagttccacaaagccctgtgtgaa
gccgccggtcagccagctccgctccacaactgtgacatctaccagtccaaagaagcaggg
aaactcctgggtgatgtgatgaagatgggcttcagtaaaccctggcccgaagccatgact
ttgattactggccagcccaaaatgtcagtccagcctctgatggaatacttccaaccgctc
atcgagtggcttgaagaggagaacaaaaagaacggtgacgtcctgggatggccagagtac
gattggacgccttacaaaatgatggaagagaagccgaaagcagtcagtttcctgggtttg
agtgtggatgaggcaggtgctgtggcgggacagtggattctcctggttctgagcatcgtc
ttcctgcttggcatcatctatttagtctacagatacgggaagactaaacgcttacaagac
aaatcgatgtctcagatggagcttaagtaa

DBGET integrated database retrieval system