KEGG   Sinocyclocheilus anshuiensis: 107653969
Entry
107653969         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04141  Protein processing in endoplasmic reticulum
sanh04210  Apoptosis
sanh04217  Necroptosis
sanh04310  Wnt signaling pathway
sanh04510  Focal adhesion
sanh04530  Tight junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107653969
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107653969
   04012 ErbB signaling pathway
    107653969
   04310 Wnt signaling pathway
    107653969
   04068 FoxO signaling pathway
    107653969
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107653969
   04137 Mitophagy - animal
    107653969
  09143 Cell growth and death
   04210 Apoptosis
    107653969
   04217 Necroptosis
    107653969
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107653969
   04530 Tight junction
    107653969
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107653969
   04621 NOD-like receptor signaling pathway
    107653969
   04622 RIG-I-like receptor signaling pathway
    107653969
   04625 C-type lectin receptor signaling pathway
    107653969
  09152 Endocrine system
   04910 Insulin signaling pathway
    107653969
   04920 Adipocytokine signaling pathway
    107653969
   04912 GnRH signaling pathway
    107653969
   04914 Progesterone-mediated oocyte maturation
    107653969
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107653969
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107653969
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107653969
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107653969
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 107653969
NCBI-ProteinID: XP_016296310
LinkDB
Position
Unknown
AA seq 422 aa
MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHVLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLHVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFMLKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSDHNRLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWFDPSEVEAPPPAITDKQLDEREHTVEEWKELIYKEV
LDWEERTKNGVIRGQPASLGAAVSNDSHEPSTSSSSTNDVSSMSTDTDSSQEASAGPLGC
CR
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaacaggaataagcgcgagaaggaatattacagcatagatgtaggagattcaacgttt
accgttttgaagcgatatcagaatttaagaccaatcggatctggggcacaaggcatcgtc
tgctcagcgtatgatcatgtcctcgaacgaaatgttgcaattaagaaacttagccgaccc
tttcagaaccaaacccacgccaaacgggcctacagagaactggtgctcatgaaatgtgtc
aaccacaaaaatataattggcttactacatgtgttcacgccacagaagacacttgaagaa
ttccaggatgtgtatctggtgatggagctgatggatgctaacctgtgccaggtcattcag
atggagctggaccacgagagactctcatacctgctttatcagatgctctgcggcatcaaa
cacctacacgctgctggcatcatacacagggatctgaagcccagtaacatagtagtgaaa
tccgactgtacgctgaagatcctggacttcggtctggcccggacagccgccaccggcctc
ctcatgactccttacgtggtgacgcgctactaccgtgcccctgaggtcattctgggcatg
ggttaccaagccaatgttgatgtctggtctgttggctgcatcatggctgaaatggtcaga
ggtagtgtgttgtttcccggcacagaccacattgaccagtggaacaaggtgatcgagcag
ctgggcacaccgtctcaggagttcatgctgaagctcaaccagtctgtgaggacttacgtg
gagaaccggccccgctatgctggatacagctttgagaagctcttcccagatgtgctgttc
cctgcagactccgaccacaacagactgaaggcgagccaggcgcgagacttgttatccaaa
atgctggtaatagatgcgtctaaacggatctcggtggacgaggccctccagcacccctac
atcaacgtgtggttcgacccgtcagaagtggaagcgccgccgccggcgatcaccgataaa
cagctggatgagagagaacacacggtggaggagtggaaagagctgatatataaggaagta
ctggattgggaggaacgaacgaaaaacggggtgatccgaggacagccggcctcactaggt
gcagcagtgagcaatgactcccacgagccctcgacgtcctcgtcctccacaaacgacgtc
tcgtccatgtccaccgacacagacagcagtcaggaggcgagcgcaggaccgctgggctgc
tgcagatga

KEGG   Sinocyclocheilus anshuiensis: 107662288
Entry
107662288         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04141  Protein processing in endoplasmic reticulum
sanh04210  Apoptosis
sanh04217  Necroptosis
sanh04310  Wnt signaling pathway
sanh04510  Focal adhesion
sanh04530  Tight junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107662288
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107662288
   04012 ErbB signaling pathway
    107662288
   04310 Wnt signaling pathway
    107662288
   04068 FoxO signaling pathway
    107662288
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107662288
   04137 Mitophagy - animal
    107662288
  09143 Cell growth and death
   04210 Apoptosis
    107662288
   04217 Necroptosis
    107662288
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107662288
   04530 Tight junction
    107662288
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107662288
   04621 NOD-like receptor signaling pathway
    107662288
   04622 RIG-I-like receptor signaling pathway
    107662288
   04625 C-type lectin receptor signaling pathway
    107662288
  09152 Endocrine system
   04910 Insulin signaling pathway
    107662288
   04920 Adipocytokine signaling pathway
    107662288
   04912 GnRH signaling pathway
    107662288
   04914 Progesterone-mediated oocyte maturation
    107662288
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107662288
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107662288
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107662288
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107662288
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107662288
NCBI-ProteinID: XP_016307745
UniProt: A0A671R7M7
LinkDB
Position
Unknown
AA seq 472 aa
MNRHFLYNCSAPVLDVKIAFCQGFGKQVDVSYIAQHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYIN
VWYDPAEVEAARNQQISMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKG
QPSPSGAAMNGSESLPPSSSVNDISSMSTDQTLASDTDSSLETSTGPLGCCR
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaacagacatttcttatataactgcagtgctccagtcctggatgtgaagattgccttt
tgtcaggggtttggcaaacaagttgatgtttcttacattgcccagcattacaacatgagt
aaaagcaaagtggacaaccagttctacagtgtggaagtaggagattccaccttcacggtt
ctcaaacggtaccaaaatctaaagcccatcggttctggggctcagggaatagtgtgtgct
ggatatgatgccgtcctggacagaaatgtggccattaagaaactcagcagaccttttcag
aaccagactcacgccaagagagcatacagggagctggtgcttatgaaatgtgtcaatcac
aaaaacatcatcagcttattaaatgtcttcacaccacagaagtctttagaggaattccaa
gatgtttacctggtcatggagctgatggatgcaaacctttgccaggtgattcagatggaa
ctggaccatgagaggatgtcctacctgctgtaccagatgttatgtggaattaaacacctg
cactcagccggcatcatccacagggatctgaaacctagcaatattgtggtgaaatccgac
tgtaccctgaagatcttggactttggcttggcgagaaccgctggcactagctttatgatg
acgccctacgtggtgacgcggtactacagggccccggaggtcatcctgggcatgggctac
aaggagaacgtggatatttggtcagttggttgcatcatgggagaaatggtgcgccacaaa
atcctattccccggcagggattacatcgaccaatggaataaggttatagagcagctcggc
acgccctctcctgagttcatgaagaaactgcagccgacggtgcgtaactatgtggagaac
aggccaaaatacgccggcctgaccttccccaaactcttccctgattgcctcttccctgca
gactcggagcacaacaagctcaaagctagtcaggccagagacctgctgtctaagatgctg
atcattgatcccgctaagcggatctcagtggacgaggccctgcagcacccctacatcaac
gtgtggtacgacccggccgaggtggaggcagccaggaatcagcagatatctatgcctcct
ccacagatctatgataaacagctagatgagagggaacactcgattgatgaatggaaagag
ctcatctataaagaggtgatgaacttcgaggagagaacaaagaatggtgttgtgaaggga
cagccctctccctcaggtgcagccatgaacggcagcgagagcctccccccttcctcctcc
gtcaacgacatctcctccatgtccaccgaccagaccctggcctccgataccgacagcagc
ttggagacctccaccggaccgctggggtgctgcaggtga

KEGG   Sinocyclocheilus anshuiensis: 107667593
Entry
107667593         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04141  Protein processing in endoplasmic reticulum
sanh04210  Apoptosis
sanh04217  Necroptosis
sanh04310  Wnt signaling pathway
sanh04510  Focal adhesion
sanh04530  Tight junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107667593
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107667593
   04012 ErbB signaling pathway
    107667593
   04310 Wnt signaling pathway
    107667593
   04068 FoxO signaling pathway
    107667593
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107667593
   04137 Mitophagy - animal
    107667593
  09143 Cell growth and death
   04210 Apoptosis
    107667593
   04217 Necroptosis
    107667593
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107667593
   04530 Tight junction
    107667593
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107667593
   04621 NOD-like receptor signaling pathway
    107667593
   04622 RIG-I-like receptor signaling pathway
    107667593
   04625 C-type lectin receptor signaling pathway
    107667593
  09152 Endocrine system
   04910 Insulin signaling pathway
    107667593
   04920 Adipocytokine signaling pathway
    107667593
   04912 GnRH signaling pathway
    107667593
   04914 Progesterone-mediated oocyte maturation
    107667593
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107667593
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107667593
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107667593
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107667593
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 107667593
NCBI-ProteinID: XP_016314786
UniProt: A0A671QI40
LinkDB
Position
Unknown
AA seq 422 aa
MTEGEGQFYSVQVGDSTFTVLRRYQQLCAIGYGAQGIVCSALDTVLGIPVAVKKLSRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLLNVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEILG
TPSLEFMNRLMETVRNYVMNKPQFPGVSFNELFPDWAFPSETEHDQIKTSQARDLLSKML
VIDPESRISVQEALSHPYIHVWYDPAEADTPPPQISDKQLEEREHSIEQWKELIYKEVMD
WEERNKNGVLKEECLVDGTVNSSTTASQSSSINDISSMSTEQTLASDTDSSCIDTLTGPL
EE
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaccgagggggaggggcagttctacagcgtgcaggtgggtgattccacctttacggtg
ctcagaaggtaccagcagctctgcgccatcggatacggtgcccagggtatcgtctgctcc
gctctggacactgtacttggcatcccagtcgctgtgaagaaactgagccggccctttcag
aaccagacccatgcgaagagggcttacagagagctggttctgctcaagtgtgttaatcac
aagaatatcatccgtttgcttaatgtcttcacaccccagaagtcattggaagagtttcag
gatttgtacttggtaatggaactgatggacgctagcctttgtcaggtgatccacatggac
ctggaccatgagaggatgtcttacctgctctaccagatcctgtgtggcatcagacatcta
cactcagctggcatcattcacagggatctgaagcccagtaacatcgtagtgaagtctgac
tgcaccttaaagatcctagacttcgggctggccagaaccgcctgcactaacttcatgatg
acgccctacgtagtaaccagatactacagagcaccagaggtcatcttgggcatgaaatat
aaggagaatgttgatatctggtcggtgggttgcatcatgggtgagatggtcaaaggaagt
gtcatattccagggcactgatcatattgaccagtggaataaagtgattgagattctggga
accccctctctggagtttatgaaccgtttaatggagactgtaaggaactatgtgatgaac
aaaccccagtttcctggagtcagttttaacgagctttttcctgattgggccttcccttca
gagactgagcatgaccagatcaaaactagtcaagcacgagacctgctgtccaagatgctg
gtaatcgaccctgaaagccgcatctctgtgcaggaggccctcagtcacccttacatccat
gtgtggtatgacccagctgaggccgatacgcctcctccgcagatatcagacaagcagttg
gaggagcgggaacacagcattgagcagtggaaagagttgatttataaagaagtaatggac
tgggaggagaggaacaagaacggagtgctgaaagaggagtgtttagtagacggtacggtg
aacagcagcaccactgcctcccagtcatcctctattaacgacatctcgtccatgtcgacg
gagcagacattggcctcagacactgacagctcctgcatcgacaccctcacaggaccgtta
gaggagtga

KEGG   Sinocyclocheilus anshuiensis: 107668799
Entry
107668799         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 8B isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04141  Protein processing in endoplasmic reticulum
sanh04210  Apoptosis
sanh04217  Necroptosis
sanh04310  Wnt signaling pathway
sanh04510  Focal adhesion
sanh04530  Tight junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107668799
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107668799
   04012 ErbB signaling pathway
    107668799
   04310 Wnt signaling pathway
    107668799
   04068 FoxO signaling pathway
    107668799
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107668799
   04137 Mitophagy - animal
    107668799
  09143 Cell growth and death
   04210 Apoptosis
    107668799
   04217 Necroptosis
    107668799
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107668799
   04530 Tight junction
    107668799
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107668799
   04621 NOD-like receptor signaling pathway
    107668799
   04622 RIG-I-like receptor signaling pathway
    107668799
   04625 C-type lectin receptor signaling pathway
    107668799
  09152 Endocrine system
   04910 Insulin signaling pathway
    107668799
   04920 Adipocytokine signaling pathway
    107668799
   04912 GnRH signaling pathway
    107668799
   04914 Progesterone-mediated oocyte maturation
    107668799
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107668799
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107668799
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107668799
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107668799
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 107668799
NCBI-ProteinID: XP_016316274
UniProt: A0A671R3B9
LinkDB
Position
Unknown
AA seq 426 aa
MNKNKREKEFYSVDVGDSTFTVLKRYQNLKPIGSGAQGIVCSAYDHNLERSVAIKKLSRP
FQNQTHAKRAFRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQTLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGSDHIDQWNKVIEQ
LGTPSQEFMMKLNQSVRTYVENRPRYTGYSFEKLFPDVLFPADSEHNKLKASQARDLLSR
MLVIDASKRISVDEALQHPYINVWYDPAEVEAPPPLITDKQLNEREHTVEEWKELIYKEV
LDWEERIKNVIRGQPSPIGTAVINGSPQPSSSSSINDVSSMSTEPTVASDTDSSLEASAG
PLSCCR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgaacaaaaataagcgagaaaaagaattctacagcgtagatgtgggtgattcaacattc
acagtgttgaagcggtatcagaatctaaaacccattggctcgggtgctcagggaatagtc
tgctcagcgtatgaccacaaccttgagcgaagtgtggctataaagaaactcagccggcct
tttcagaatcagactcatgccaaacgcgcattcagagagctggtgctcatgaagtgtgtc
aaccataaaaatataataggcctcttaaatgtttttacaccacaaaaaacattagaagaa
ttccaagatgtttacctagtaatggagctgatggacgccaacctctgccaagtcattcag
atggaactggaccacgagcggctgtcctatctgctgtaccagacgctgtgcggaataaaa
cacctccactcggcggggatcatccacagggatctgaaacccagcaacatcgtggtaaag
tcagactgtaccctgaagatcctggatttcggactggccaggacagcagctacgggtctg
ctgatgacaccatatgtggtgacccgttactacagagcccctgaagtcatcctgggaatg
ggatatcaagccaatgtggatgtatggtctgttggctgtatcatggctgaaatggtcaga
ggtagtgtgttgtttccaggttcagatcatattgatcagtggaacaaagtcatagagcag
ctgggaacaccatcccaggagtttatgatgaaactcaaccagtctgtgcggacctacgtg
gagaacaggccccggtacactggatacagctttgagaagctctttcccgacgtcctgttc
cctgctgattcagaacacaacaaactgaaagcgagccaggcgcgggacctgctgtctaga
atgctggtgatagatgcatccaaacgaatatctgtggatgaagctctgcagcacccctac
attaacgtgtggtacgacccagctgaagtggaagcgccacctcctctaatcacagacaaa
cagctcaatgagagggaacacacagtggaggaatggaaagagctgatctataaagaagtc
ctggattgggaagaacggataaaaaatgtaattcgaggtcagccttcccctataggtaca
gcagtgatcaacggctcaccccagccctcctcctcgtcctccatcaatgacgtctcgtcc
atgtccacagagcccaccgtggcctcagacacagacagcagcctggaggcctctgcagga
cccctgagctgctgcagatga

KEGG   Sinocyclocheilus anshuiensis: 107673832
Entry
107673832         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04141  Protein processing in endoplasmic reticulum
sanh04210  Apoptosis
sanh04217  Necroptosis
sanh04310  Wnt signaling pathway
sanh04510  Focal adhesion
sanh04530  Tight junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107673832
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107673832
   04012 ErbB signaling pathway
    107673832
   04310 Wnt signaling pathway
    107673832
   04068 FoxO signaling pathway
    107673832
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107673832
   04137 Mitophagy - animal
    107673832
  09143 Cell growth and death
   04210 Apoptosis
    107673832
   04217 Necroptosis
    107673832
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107673832
   04530 Tight junction
    107673832
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107673832
   04621 NOD-like receptor signaling pathway
    107673832
   04622 RIG-I-like receptor signaling pathway
    107673832
   04625 C-type lectin receptor signaling pathway
    107673832
  09152 Endocrine system
   04910 Insulin signaling pathway
    107673832
   04920 Adipocytokine signaling pathway
    107673832
   04912 GnRH signaling pathway
    107673832
   04914 Progesterone-mediated oocyte maturation
    107673832
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107673832
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107673832
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107673832
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107673832
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like DDE_Tnp_1_7
Other DBs
NCBI-GeneID: 107673832
NCBI-ProteinID: XP_016323127
LinkDB
Position
Unknown
AA seq 422 aa
MTEGEGQFYSVQVGDSTFTVLRRFQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLSRPFQ
NQTHAKRAYRELVLLKCVNHKNIIHLLNVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEILG
TPSLEFMNRLMETVRNYVLNKPQFPGVSFNELFPDWAFPSETEHDEIKTSQARDLLSKML
VIDPESRISVQEALNHPYIRVWYDPAEADAPPPQISDKQLEEREHSIEQWKELIYKEVID
WEERNKNGVLKEECLVDGTVNSSTTASQSSSINDISSMSTEQTLASDTDSSCIDTLTGPL
EE
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaccgagggggaggggcagttctacagcgtgcaggtgggtgactccacctttacagtg
ctcagaaggttccagcagctccgcgccatcggatccggtgcccagggtatcgtctgctcc
gctctggacaccgttcttggcatcccagtcgctgtgaagaagctgagccggccctttcag
aaccagacccatgcgaagagggcttacagagagctggttctgctcaagtgtgttaatcac
aagaacatcatccatttgcttaatgtcttcacaccccagaagtcattggaagagtttcag
gatttgtacttggtaatggaactgatggacgctagcctttgtcaggtgatccacatggac
ctggaccatgagaggatgtcttacctgctctaccagatcctgtgtggcatcagacatcta
cactcagctggcatcattcacagggatctgaagcctagtaacatcgtagtgaagtctgac
tgcacgctaaagatcttagactttgggctggccagaaccgcctgcactaacttcatgatg
acaccctacgtagtaaccagatactacagagcaccagaggtcatcttgggaatgaaatat
aaggagaatgtggatatctggtcggtgggctgcatcatgggtgagatggtcaaaggaagt
gtcatattccagggcactgatcatattgaccagtggaataaagtgattgagattctggga
accccctctctggagtttatgaaccgtttgatggagactgtaaggaactatgtgctgaac
aaacctcagtttcctggagtcagctttaatgagctttttcccgattgggccttcccttca
gagactgagcatgacgagatcaaaactagtcaagcacgagacctgctgtccaagatgctg
gtaatcgaccctgaaagccgcatctctgtgcaggaggccctcaatcacccttacatccgt
gtgtggtacgacccagccgaggccgatgcgcctcctccgcagatatcagacaagcagttg
gaggagcgggaacacagcattgagcagtggaaagagttgatttataaagaagtaatagac
tgggaggagaggaacaagaatggagtgctgaaagaggagtgtttagtagacggtacggtg
aacagcagcaccactgcctcccagtcatcctctattaatgacatctcgtccatgtcaacg
gagcagacattggcctcagacaccgacagctcctgcatcgacaccctcacaggaccatta
gaggagtga

KEGG   Sinocyclocheilus anshuiensis: 107673914
Entry
107673914         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 8A isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04141  Protein processing in endoplasmic reticulum
sanh04210  Apoptosis
sanh04217  Necroptosis
sanh04310  Wnt signaling pathway
sanh04510  Focal adhesion
sanh04530  Tight junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107673914
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107673914
   04012 ErbB signaling pathway
    107673914
   04310 Wnt signaling pathway
    107673914
   04068 FoxO signaling pathway
    107673914
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107673914
   04137 Mitophagy - animal
    107673914
  09143 Cell growth and death
   04210 Apoptosis
    107673914
   04217 Necroptosis
    107673914
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107673914
   04530 Tight junction
    107673914
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107673914
   04621 NOD-like receptor signaling pathway
    107673914
   04622 RIG-I-like receptor signaling pathway
    107673914
   04625 C-type lectin receptor signaling pathway
    107673914
  09152 Endocrine system
   04910 Insulin signaling pathway
    107673914
   04920 Adipocytokine signaling pathway
    107673914
   04912 GnRH signaling pathway
    107673914
   04914 Progesterone-mediated oocyte maturation
    107673914
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107673914
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107673914
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107673914
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107673914
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 107673914
NCBI-ProteinID: XP_016323218
UniProt: A0A671PU00
LinkDB
Position
Unknown
AA seq 427 aa
MNKNKQEKEFYSVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTSQKSLDEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDIWSVGCILAEMVRHKILFPGRDYIDQWNKVIEQ
LGTPSQEFMMKLNQSVRTYVENRPRYTGFSFEKLFPDVLFPAESEHNKLKASQARDLLSK
MLVIDASKRISVEEALQHPYINVWYDPAEVEAPPPLITDKQLDERDHTVEEWKELIYKEV
LDWEERMKNGVIRGQPSPLGGAVINGSPQPSSSSSINDVSSMSTEPTVASDTDSSLEASA
GPLSCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaacaaaaataagcaagaaaaagaattctacagcgtagatgtgggtgattcaacattc
acagtgttgaagcggtatcagaatctaagacccattggctcgggtgctcagggaatagtc
tgctcagcgtatgaccacaaccttgagcgaaatgtggctataaagaaactcagccggcct
tttcagaatcagactcatgccaaacgcgcatacagagagctggtgctcatgaagtgtgtc
aaccataaaaacataataggtctgttaaatgtttttacatcacaaaaatcattagacgaa
ttccaagatgtttacctagtaatggagctgatggatgccaacctctgccaagtcattcag
atggagctggaccacgagcggctgtcctatctgctgtaccagatgctgtgcggaataaaa
cacctccactcggcggggatcatccacagggatctgaaacccagtaacattgtggtaaag
tcagactgtaccctgaagatcctggatttcggtctggccaggacagcagctacaggtctg
ctgatgacaccatatgtggtgacacgttactacagggcccctgaagtcatcctgggaatg
ggatatcaagccaatgtggacatttggtctgtgggctgcattttggcagaaatggtccgt
cacaaaatcctttttcctgggagggactatattgatcagtggaacaaagtcatagagcag
ctgggaacaccatcccaggagttcatgatgaaactcaaccagtctgtgcggacctatgtg
gagaacaggccgcggtacactggattcagctttgagaagctcttccccgatgtcctgttc
cctgctgagtcagaacacaacaaactgaaagcgagccaggcgcgggacctgctgtctaaa
atgctggtgatagatgcatccaagcgaatctctgtggaggaagctctgcagcacccctac
attaacgtgtggtacgacccagctgaagtggaagcgccacctcctctaatcacagacaaa
cagctcgatgagagggatcacacagtggaggagtggaaagagctgatctataaagaagtc
ctggattgggaagaacggatgaaaaacggtgttattcgaggtcagccttcccctttaggt
ggagcagtgatcaacggctcaccccagccctcctcctcttcctccattaatgatgtctcc
tccatgtccacagagcccaccgtggcctctgacacagacagcagccttgaggcctccgca
ggacccctgagctgctgcagatga

KEGG   Sinocyclocheilus anshuiensis: 107693656
Entry
107693656         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 8B-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04141  Protein processing in endoplasmic reticulum
sanh04210  Apoptosis
sanh04217  Necroptosis
sanh04310  Wnt signaling pathway
sanh04510  Focal adhesion
sanh04530  Tight junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107693656
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107693656
   04012 ErbB signaling pathway
    107693656
   04310 Wnt signaling pathway
    107693656
   04068 FoxO signaling pathway
    107693656
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107693656
   04137 Mitophagy - animal
    107693656
  09143 Cell growth and death
   04210 Apoptosis
    107693656
   04217 Necroptosis
    107693656
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107693656
   04530 Tight junction
    107693656
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107693656
   04621 NOD-like receptor signaling pathway
    107693656
   04622 RIG-I-like receptor signaling pathway
    107693656
   04625 C-type lectin receptor signaling pathway
    107693656
  09152 Endocrine system
   04910 Insulin signaling pathway
    107693656
   04920 Adipocytokine signaling pathway
    107693656
   04912 GnRH signaling pathway
    107693656
   04914 Progesterone-mediated oocyte maturation
    107693656
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107693656
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107693656
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107693656
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107693656
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF530
Other DBs
NCBI-GeneID: 107693656
NCBI-ProteinID: XP_016348599
LinkDB
Position
Unknown
AA seq 414 aa
MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHVLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLMQIPT
CENVTSLLTPDLFSCQDLKPSNIVVKSDCTLKILDFGLARTAATGLLLTPYVVTRYYRAP
EVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQLGTPSQEFMLKLNQ
SVRTYVENRPRYAGYSFEKLFPDVLFPADSDHNKLKASQARELLSKMLVIDASKRISVDE
ALQHPYINVWYDPSEVEAPPPVITDKQLDEREHTVEEWKELIYKEVLDLEERTKNGVIRG
QPASLGAAVSNDSHEPSTSSSSTNDVSSMSTDPTLTSDTDSSQEAPAGPLGCCR
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgaacaggaataagcgtgagaaggaatactacagcatagatgtaggagattccacgttc
accgttttgaagcgctatcagaatttaagaccaatcggatctggagcacaaggcattgtc
tgctccgcgtacgaccatgtccttgaacgaaatgttgcaattaagaaacttagccgaccc
tttcagaaccaaacccacgccaaacgggcctacagagaactggtcctgatgaaatgtgtc
aaccacaaaaatataattggcttactaaacgtgttcacgcctcagaagacacttgaagaa
ttccaggatgtgtatctggtgatggagctgatggatgctaacctaatgcagattcccacc
tgtgagaatgtgacgtcccttctgacccctgacctcttctcttgtcaggatctaaaaccc
agtaacatagtagtgaaatcagactgtacgctgaagatcctcgactttggcctggcccgg
acagccgccaccggcctcctcctgactccttacgtggtgacgcgctactaccgtgctccc
gaggtcattcttggcatgggttaccaagccaatgttgatgtctggtctgttggctgcatc
atggctgaaatggtcagaggtagtgtgttgtttcctggcacagaccacatcgaccagtgg
aacaaggtgatcgagcagctgggcacaccgtctcaggagttcatgctgaagctcaaccag
tccgtgaggacttacgtggagaaccggccccgctatgctggatacagctttgagaagctc
ttcccagacgtgctcttccctgcagactccgaccacaacaaactgaaagcgagtcaggcg
cgagagttgttatccaaaatgctggtaatagatgcgtctaaacgaatctcggtggacgag
gccctccagcacccctacatcaacgtgtggtacgacccgtcagaagtggaagcgccgcca
ccggtgatcacggataaacagctagatgagagagaacacacagtggaagagtggaaagag
ctgatatataaggaagtgctggacttggaggaacgaacgaaaaacggggttatccgagga
cagccggcctcgctaggtgcagcagtgagcaatgactcccatgagccctcgacgtcctcg
tcctccacaaacgacgtctcgtccatgtccaccgaccccaccctgacctcggacacagac
agcagtcaggaggcgcccgcaggaccgctgggctgctgcagatga

KEGG   Sinocyclocheilus anshuiensis: 107701924
Entry
107701924         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 10-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04137  Mitophagy - animal
sanh04140  Autophagy - animal
sanh04141  Protein processing in endoplasmic reticulum
sanh04210  Apoptosis
sanh04217  Necroptosis
sanh04310  Wnt signaling pathway
sanh04510  Focal adhesion
sanh04530  Tight junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107701924
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107701924
   04012 ErbB signaling pathway
    107701924
   04310 Wnt signaling pathway
    107701924
   04068 FoxO signaling pathway
    107701924
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107701924
   04137 Mitophagy - animal
    107701924
  09143 Cell growth and death
   04210 Apoptosis
    107701924
   04217 Necroptosis
    107701924
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107701924
   04530 Tight junction
    107701924
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107701924
   04621 NOD-like receptor signaling pathway
    107701924
   04622 RIG-I-like receptor signaling pathway
    107701924
   04625 C-type lectin receptor signaling pathway
    107701924
  09152 Endocrine system
   04910 Insulin signaling pathway
    107701924
   04920 Adipocytokine signaling pathway
    107701924
   04912 GnRH signaling pathway
    107701924
   04914 Progesterone-mediated oocyte maturation
    107701924
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107701924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107701924
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107701924
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107701924
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107701924
NCBI-ProteinID: XP_016359564
LinkDB
Position
Unknown
AA seq 464 aa
MYMQKQVFMNRHFLYNCSAPVLDVKIAFCQGFGKQVDVSYIAQHYNMSKSKVDNQFYSVE
VGDSTFTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL
VLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQ
MLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAP
EVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQP
TVRNYVENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDE
ALQHPYINVWYDPTEVEAARNQQISMIDEWKELIYKEVMNFEERTKNGVVKGQPSPSGAA
VNSSDSLPPSSSVNDISSMSTDQTLASDTDSSLETSTGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgtacatgcaaaagcaggtatttatgaacagacatttcttatataactgcagtgctcca
gtcctggatgtgaagattgccttttgtcaggggtttggtaaacaagttgatgtttcttac
atcgcccagcattacaacatgagcaaaagcaaagtggacaaccagttctacagtgtggaa
gtaggagattccaccttcacggttctcaaacggtaccaaaatctaaagcccatcggttct
ggggctcagggaatagtgtgtgctggatatgacgccgtcttggacagaaatgtggccatt
aagaaactcagcagaccttttcagaaccagactcatgccaagagagcatacagggagctg
gtgcttatgaaatgtgtcaatcacaaaaacatcatcagcttattaaatgtcttcacacca
cagaagtctttagaggaattccaagatgtttacctggtcatggagttgatggatgcaaac
ctttgccaggtgattcagatggagctggaccacgagaggatgtcctacctgctgtaccag
atgttgtgtggaatcaaacacctgcactcagccggcatcatccacagggatctgaaacct
agcaatattgtggtgaaatccgactgtacgctgaagatcttggactttgggttggcgaga
actgctggcactagctttatgatgacaccctacgtggtgacgcggtactacagggccccg
gaggtcatcctgggcatgggatacaaggagaacgtggatatttggtcagttggttgcatc
atgggtgaaatggtgcgccacaaaatcctattccccggcagggattacattgaccaatgg
aataaggttatagagcagctcggcacgccctctcctgagttcatgaagaaactgcagccg
acggtgcgtaactacgtggagaacagaccaaaatacgccggcctgaccttccccaaactc
ttccctgattgcctcttccctgcagactcggagcacaacaaactcaaagctagtcaggcc
agagacctgctgtctaagatgttgatcattgatcccgctaagcggatctcagtggacgag
gccctgcagcacccctacatcaacgtgtggtacgacccgaccgaggtggaggcagccagg
aatcagcagatatctatgattgatgaatggaaagagctcatctataaagaggtgatgaac
ttcgaggagagaacaaagaatggtgtggtgaagggacagccctctccctcaggtgcagcc
gtgaacagcagcgacagcctccccccctcctcctctgtcaacgacatctcctccatgtcc
accgaccagaccttggcctctgataccgacagcagcctggagacctccaccggaccactg
gggtgctgcaggtga

DBGET integrated database retrieval system