KEGG   Sinocyclocheilus anshuiensis: 107654524Help
Entry
107654524         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04210  Apoptosis
sanh04625  C-type lectin receptor signaling pathway
sanh04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107654524
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107654524
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107654524
   04672 Intestinal immune network for IgA production
    107654524
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107654524
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107654524
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: STE group
  Other
   107654524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo APH FTA2
Motif
Other DBs
NCBI-GeneID: 107654524
NCBI-ProteinID: XP_016297109
LinkDB All DBs
Position
Unknown
AA seq 845 aa AA seqDB search
MPRILNSTVPFSHMAQRDIKALNCPSSGPASRTESKGGERDKTNQLNIWTAVYRGTADHE
WTQRTEKQSIIAQAECESQDSQEFCPNGSISSQSLLGTISRSRPRKKRHKKHRRKRDEKD
SRVSESVGVTGVPEQDSGECLSSSLIQVRDPVCISSSNNSSTTYSSSGLSTERVSVQETE
GPSYSYPWESRRTSLPRLPCCQSYSQDSEELNSPLRSETECPLAVTALRNFVTSEDRCFA
YGFVKDVLREERERDEDEREESDKNEGILFKEGLQPVNYEYREGREYECCRFLKQGSFGE
VYSIKDKGTGFMCAAKKVPLVSFSSEEVGSWSALQSPQVVELFGVVREGPSIILFMDLKS
SSLGQLVEERGRLPEDLSLHYLQQVLGALNQLHRKRILHLDIKADNILLSEDGKDAFLCD
FGYSERLDKQGLSYCKSLKGTETHMAPEVVLNEPRSSKADIWSSCCMLLHMLNGCHPWTR
YYSRPLYLKIAEEPPPVREIPCDCSSYTADVIRSGLQKDPNKRASAKELFVKTAKALKEV
GGLHSPARGGTYQKPLGKPENPDSAHSATPTTSHHTTPSDNSEQQWMSLEHKRRAGDGER
HDKPDKVKQWKRTEETRNDDHSPPKSLLHIQSTSPEPQIINKTEPEPTVPEKELWKDFYV
SSLSHPHSAELQEQWLSCLGSDCFSPREYWDKKDSGRWSFGPGDDLSSGVFSYNSQQDGQ
SFSRDWLAPKHQPPPRCFDGVDVYIRDFDGKCFHIRETPGVKVGHVARGISDQISENVFS
LQTEDGCLVPLDKEVLENSLFLRCVPAPDSSHYHQYGHNPCCTLGPDCKLPWSWRIREGV
LETRD
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaatcttgaactccactgtcccgttctcccacatggcccaaagggacatcaaa
gctctcaactgccccagctcgggcccagcctctcgcacagagagcaaaggaggagagcgg
gacaaaacaaatcagttgaacatctggacagccgtgtatcgtggaactgccgaccatgag
tggacacagagaaccgagaaacagtccattattgcacaggcagagtgtgagtcccaggat
tcacaggagttctgccccaatggcagcatctcctcccagtcgcttcttggaaccatctct
cgcagtcggcccagaaagaaacgtcataagaaacatcggcgaaagcgggacgagaaggac
agccgagtgagtgagtccgtgggagtcactggagtgccagaacaggacagcggcgagtgc
ctttcttcatctctcattcaggttagagatccagtgtgcatcagcagcagcaacaacagt
agtactacatacagcagcagtggcctcagcacggagagggtgtctgtgcaggaaacagag
ggcccgtcgtactcttatccgtgggagtcccggcggacctccttacccagactcccctgc
tgccagagctacagccaagacagcgaggagctgaattctcccctgagaagtgagactgaa
tgccctctggctgttacagccctgaggaactttgtaacaagcgaagatcgctgctttgca
tacggctttgtcaaagatgtgctgagagaggagagagagagagatgaggacgagagagag
gagagcgacaagaatgaagggatcctgttcaaagaggggctacaaccagtaaattatgag
tacagagagggacgggaatatgaatgctgtagatttctcaagcagggctccttcggagag
gtctacagcatcaaagacaaaggcaccggcttcatgtgtgccgccaaaaaggtgccgttg
gtgagtttcagcagtgaggaggtgggctcgtggagtgccctgcagtctcctcaggtggtg
gaactctttggagtggtgcgtgaaggtccttccatcatcctcttcatggaccttaaatcc
agttctctaggacagctggtggaggaacgaggccgcctgccagaggatctgtccctgcac
taccttcagcaagtattgggggcgctaaaccaactgcataggaagcgcatccttcatcta
gacatcaaagcggataatattttgctgtcagaagatgggaaagatgcattcctgtgtgac
tttggatactcggagagattggacaaacaagggcttagttattgtaagagtctgaaaggc
acagaaactcatatggcacccgaggtggtgctcaatgagccgcgctcttcaaaagcagac
atctggagcagctgctgtatgcttctgcacatgctcaacggctgtcatccgtggacccgc
tactattcccgcccactatacctcaagatagcagaagagcctccgccagtgagggaaatc
ccatgtgactgcagctcctatacagcagatgtcataagatcaggactgcagaaagatcca
aacaaacgagcctctgccaaagaactctttgttaaaactgctaaagcacttaaagaagtg
gggggacttcacagccccgcgagaggaggaacctatcagaagccactggggaagccagag
aatccagactccgcccattcagccacacccaccacatcccaccacaccacgccctctgat
aactctgagcagcagtggatgagcttggagcacaagaggagagcgggtgatggagaacgt
catgacaagccagacaaggtaaaacagtggaaacggacagaggagaccagaaacgatgac
cactctcctccgaagtcactgctccacattcaaagcacttcacctgagccacagatcatc
aataagaccgagccagaaccaacagtgccggaaaaagagctgtggaaagatttctatgtg
agcagtctttcccatcctcattctgctgagctgcaggagcagtggctctcttgtctcggt
agcgactgcttttcccctagagaatactgggacaagaaggattcagggcgttggtcattc
ggtcctggtgatgaccttagctcaggcgtgttttcttacaacagccaacaagatggccag
agcttcagcagggactggctcgctcccaaacatcaacccccgccccgctgctttgacggg
gtggatgtttatattagggactttgacgggaaatgctttcacattcgggagacgcccggg
gtgaaagtaggccacgttgcaagaggaatcagcgatcagatctcagagaacgtgttcagt
ctgcaaacagaggatggttgcttggtgccccttgacaaagaggtcctagagaacagcctg
tttttgcgctgcgtcccggcccctgactccagccactatcatcagtacggacacaacccc
tgctgcaccctcggccccgactgcaaactgccatggagctggaggatcagagagggggtg
ctggagactagagactga

DBGET integrated database retrieval system