KEGG   Sinocyclocheilus anshuiensis: 107655601Help
Entry
107655601         CDS       T04917                                 

Definition
(RefSeq) microsomal glutathione S-transferase 1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00480  Glutathione metabolism
sanh00980  Metabolism of xenobiotics by cytochrome P450
sanh00982  Drug metabolism - cytochrome P450
sanh00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107655601
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107655601
   00982 Drug metabolism - cytochrome P450
    107655601
   00983 Drug metabolism - other enzymes
    107655601
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sanh02000]
    107655601
Enzymes [BR:sanh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107655601
Transporters [BR:sanh02000]
 Other Transporters
  Pores ion channels [TC:1]
   107655601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG RuvC_1
Motif
Other DBs
NCBI-GeneID: 107655601
NCBI-ProteinID: XP_016298633
LinkDB All DBs
Position
Unknown
AA seq 155 aa AA seqDB search
MAEVVHMIDSEVFLAFSTYATIVVLKMMLMSFVTSYFRLTKQVFSNLEDTTLVKTTEDRK
RLVRVDPDVERVRRCHLNDLENIVPFVVIGFLYALTGPDLYTALLHFRVFVGSRFVHTVA
YVMALPQPTRGLTFGVGLFTTFSMAYRVLTTALFL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttgtacacatgattgacagcgaggttttcctggccttctccacatatgca
accatagtcgtcctcaaaatgatgctcatgagcttcgtgacctcatattttcgcttgaca
aaacaggttttttcaaacttggaggacaccaccttggtgaagaccacagaagacaggaag
aggctggtcagggttgatccagatgtggaaagagtgcgacggtgccatctaaatgacctg
gaaaacattgttccctttgtggtgatcggttttctgtatgcactcacggggccagatctc
tacacggctctgttgcacttccgggtgtttgtagggtcacgtttcgtccacacagtggcc
tatgtgatggctctgccccagcctaccagaggtctgacctttggtgtggggctgttcaca
actttttctatggcttaccgggtgctcaccacagcactttttctctaa

DBGET integrated database retrieval system