KEGG   Sinocyclocheilus anshuiensis: 107656499
Entry
107656499         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107656499
   04310 Wnt signaling pathway
    107656499
   04370 VEGF signaling pathway
    107656499
   04020 Calcium signaling pathway
    107656499
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107656499
   04218 Cellular senescence
    107656499
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107656499
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107656499
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107656499
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107656499
SSDB
Motif
Pfam: Metallophos PTEN_C2
Other DBs
NCBI-GeneID: 107656499
NCBI-ProteinID: XP_016299866
LinkDB
Position
Unknown
AA seq 508 aa
MSTKEPKEKLSTTERIIKTVPLPPHQRLTVKDLYVDGKPNAEILKNHLIKEGRVEEDVAL
RIINEGANILRQEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPDNTRYLFLGDYVDR
GYFSIECVLFLWTLKINHPNTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAF
DCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSE
KTAEHFNHNSVRGCSYFFSYAAVCDFLTNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSL
ITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVT
EMLVNVLNICSDDELMSEGDDLCEGGTPAVRKEVIRNKIRAIGKMARVFSVLREESESVL
TLKGLTPTGTLPLGVLSGGKQTLQHAAIEAKEGRAIQGFSPTRKIRNFEEARGLDRINER
MPPRKDGQQPDGTTVNAANEKNGTDGNV
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtcgaccaaagagccgaaagaaaagctgtcgaccactgaacgaattattaaaacagtg
ccactgccccctcaccagcggctgacagtgaaggacctatatgtggatggtaagcccaat
gctgagatactgaagaaccatttgatcaaagagggacgtgtggaggaggacgttgcgctg
cgcatcataaacgagggtgccaacatcctaaggcaggagaagtgcatgctagaggtggag
gctccaatcactgtatgtggtgacgttcacggacagttcttcgacctcatgaagctcttt
gaagttggtggttcccccgacaacacgcgctatctcttcctgggcgattatgtggacaga
ggatacttcagtattgagtgtgtgctgttcctgtggacattgaagatcaaccaccccaac
accctcttcctcctcagaggcaaccatgagtgtcggcacctcacagaatacttcaccttc
aaacaggaatgtaaaataaagtattcagagagggtttatgacgcatgtatggaggccttt
gactgcttgcctcttgcagctcttctaaaccagcagttcctctgtgtacatggtggcctc
tcaccagaaatcaactgcttagatgacattaggaaattagacaggtttaaggagcccccg
gcatttgggcctatgtgcgatttgatctgggccgacccgggagaggactatggcagtgag
aagacggcagagcattttaaccacaactcagtcagaggctgctcctatttcttcagttat
gcagcagtctgtgactttctgacaaacaataacctgttgtcagtaattagagcacatgaa
gcacaggacgcagggtacaggatgtacagaaaaagtcagacaactggcttcccttcatta
attaccattttctcagcaccaaattacctagatgtctataacaacaaagcagctgtattg
aaatatgaaaacaatgtcatgaacattaggcagttcaactgctctcctcacccgtactgg
ttacccaactttatggatgtgtttacgtggtcgctgccctttgtgggcgagaaagtgact
gagatgttggtgaatgtcctaaacatctgctctgatgatgaactcatgtcagagggagac
gacttatgtgaaggtggaactccagctgtccgtaaggaggtgatcagaaataagatccgt
gccattgggaaaatggccagagtcttttctgttctcagggaagagagcgagagtgtactg
accctcaaagggctcaccccaactggaacactacctttaggagtgttgtctggaggcaag
cagaccttacagcatgcagccatagaagcaaaggagggtcgagccatccaaggcttctct
cctacacggaaaatccgcaacttcgaagaagctcgtggcctggaccgaataaacgaacgg
atgcctcctcggaaggacggccagcaacctgacggtaccacagttaacgctgccaacgag
aaaaacggcactgatgggaatgtgtaa

KEGG   Sinocyclocheilus anshuiensis: 107660165
Entry
107660165         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107660165
   04310 Wnt signaling pathway
    107660165
   04370 VEGF signaling pathway
    107660165
   04020 Calcium signaling pathway
    107660165
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107660165
   04218 Cellular senescence
    107660165
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107660165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107660165
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107660165
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107660165
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107660165
NCBI-ProteinID: XP_016304890
LinkDB
Position
Unknown
AA seq 522 aa
MRMSSADIVGLNPTDRVIKSVPFPLSHRLSMREVFDCEGKPRVDLLKAHLTKEGRLEEPV
ALRIINEGAAILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYV
DRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKRLDRFKEPPAFGPMCDLLWADPLEDFG
NEKSQDYFSHNSVRGCSYFYSYPAVCEFLQTNNLLSVIRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLSICSDDELMNDEDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESEN
VLTLKGLTPTGMLPSGVLSGGKQTLQSATIEAIEAVETDEDGEAIRGFSPQHKITSFEEA
KGLDRINERMPPRRDVVNSVGLSMGKMNMAESNGTDDNSNIQ
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagaatgtccagcgcagacatcgtgggtttaaaccctaccgaccgcgtgatcaaatcg
gtgccgtttccgctgagccacaggttaagcatgcgagaggtgttcgactgcgaggggaaa
ccgcgcgtggacctgctgaaggctcacctcactaaagagggccgcttggaggagcccgta
gctctgcgcatcatcaatgagggggccgccatcctccgtcaggagaagaccatgctggac
atagaggcccctgtcacagtgtgcggggatattcacgggcagttcttcgacctgatgaag
ttatttgaggttggcgggtctcctgcgacaacgaggtacctgtttctaggggactatgtg
gaccgagggtacttcagtattgagtgtgtcctttacctctggtcgctgaaaatcctctac
ccaaagacgctgtttctgctgcggggaaaccatgaatgtagacatttgactgaatatttc
actttcaaacaagaatgtaaaatcaaatactcggagcaggtgtacgacgcgtgcatggat
gcattcgactgtctgcctctggctgctctgatgaatcagcagtttttgtgtgttcatggc
ggcctgtctccagagatacacacattagatgacattaagaggctggacaggttcaaggaa
ccgccagcatttggccccatgtgtgatctgctctgggctgacccgctggaggacttcggc
aatgaaaagagtcaagattacttcagccacaacagtgtccgcggatgctcttacttctac
agctatcctgcggtgtgtgagtttttacagaccaacaacttactgtctgtcatcagggca
catgaggcacaggatgcgggttaccgtatgtacaggaagagtcagactacaggtttccct
tctctcatcaccatcttctctgctccaaactacctggacgtttacaacaacaaagcggcc
gtgcttaaatacgagaacaacgtaatgaacatacgacagttcaactgctcgccacatcca
tactggctgcccaacttcatggacgtcttcacctggtctcttccgttcgttggagagaaa
gtgacagaaatgttggtgaatgtactcagtatctgctctgatgatgagcttatgaacgat
gaagatgagatctttgatgctaatgctgcggccgcccgtaaagaggtcatcagaaacaag
atccgtgccatcggcaaaatggccaaaatgttctcagtcctgcgagaggagagtgagaat
gtgttaaccctgaaaggtctgacccccaccggcatgctgccgagcggcgtactgtctgga
ggaaaacagaccttgcagagcgcaaccatcgaggccattgaagctgtggagacggatgag
gatggagaagccatccgtggcttttctccacagcacaagatcaccagtttcgaggaagcg
aagggtctggaccgcataaacgagcgcatgccgcctcgccgagacgtggtcaacagcgtg
gggctgtcgatgggcaagatgaacatggccgaatccaacggcacggatgacaacagcaat
atccagtga

KEGG   Sinocyclocheilus anshuiensis: 107673394
Entry
107673394         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107673394
   04310 Wnt signaling pathway
    107673394
   04370 VEGF signaling pathway
    107673394
   04020 Calcium signaling pathway
    107673394
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107673394
   04218 Cellular senescence
    107673394
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107673394
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107673394
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107673394
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107673394
SSDB
Motif
Pfam: Metallophos PTEN_C2
Other DBs
NCBI-GeneID: 107673394
NCBI-ProteinID: XP_016322454
UniProt: A0A671Q627
LinkDB
Position
Unknown
AA seq 509 aa
MSTKEPKENLSTTERIIKTVPLPPHQRLTIKDLFVDGKPNAELLKNHLIKEGRVEEDVAL
RIINEGANILRQEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPDNTRYLFLGDYVDR
GYFSVECVLFLWTLKINHSNTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAF
DCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSE
KTAEHFNHNSVRGCSYFFSYAAVCDFLTNNNLLSLIRAHEAQDAGYRMYRKSQTTGFPSL
ITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVT
EMLVNVLNICSDDELMSEGDDLCEAGGAAAVRKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGTLPLGVLSGGKQTLQNATIEAKEGQAIQGFSPTRKIHNFEEARGLDRINE
RMPPRKDGQQPDGTTVNAANEKNGTDGNV
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtcgactaaagagccgaaagaaaacctgtcgaccaccgaacgaatcattaaaacagtg
ccactgccccctcaccagcggctgacaataaaggacctatttgtggatggtaagccaaat
gccgagctactgaagaaccatttgatcaaagagggacgtgtggaggaggacgttgcgctg
cgcatcataaacgagggtgccaacatcctaaggcaggagaagtgcatgctagaggtggag
gcaccaatcactgtatgtggtgatgttcacggacagttcttcgacctcatgaagctcttt
gaagttggtggttcccccgacaacacgcgctatctcttcctgggcgattatgtagaccga
ggatacttcagtgttgagtgtgtgctgttcctgtggacattgaagatcaaccattccaac
accctcttcctcctcagaggcaaccatgagtgtcggcacctcacagaatacttcaccttc
aaacaggaatgtaaaataaagtattcagagagggtttatgacgcatgtatggaggccttc
gactgcttgcctcttgcagctcttctaaaccagcagttcctctgtgtacacggtggcctc
tcaccagaaatcaactgcttagatgacattaggaaattagaccggtttaaggagcccccg
gcatttgggcctatgtgtgatttgatctgggccgacccaggagaggactacggcagtgag
aagacggccgagcactttaaccacaactcagtcagaggctgctcctatttcttcagttat
gcagcagtttgtgactttctgacaaacaacaacctgttgtcattaatcagagcacatgaa
gcacaagacgcagggtacaggatgtacagaaaaagtcagacaacaggcttcccttcatta
attaccattttctcagcaccaaattacctggatgtctataacaacaaagcggctgtattg
aaatatgaaaacaatgtcatgaacattagacagttcaactgctctcctcacccgtattgg
ttgcccaacttcatggatgtgtttacgtggtcactaccctttgtgggcgagaaagtgact
gagatgttggtgaatgtcctaaacatctgctctgatgatgaactcatgtcagagggagac
gacttgtgtgaagcaggtggagctgcagctgtccgtaaggaggtgatcagaaataagatc
cgtgccattgggaaaatggccagagtcttttctgttctcagggaagagagtgagagtgta
ctgaccctcaaagggctcaccccaaccggaacgctacctctaggagtgttgtctggaggc
aagcagaccttgcagaatgccaccatagaagcaaaggagggtcaagccatccaaggcttc
tctcctacacggaaaatccacaacttcgaagaagctcgtggcctggaccgaataaacgaa
cggatgcctcctcgcaaggacggccagcaacctgacggtaccacagttaatgctgccaac
gagaaaaacggcactgacgggaatgtgtaa

KEGG   Sinocyclocheilus anshuiensis: 107676124
Entry
107676124         CDS       T04917                                 

Definition
(RefSeq) calcineurin subunit B type 1-like
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107676124
   04310 Wnt signaling pathway
    107676124
   04370 VEGF signaling pathway
    107676124
   04020 Calcium signaling pathway
    107676124
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107676124
   04218 Cellular senescence
    107676124
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107676124
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107676124
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107676124
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9
Other DBs
NCBI-GeneID: 107676124
NCBI-ProteinID: XP_016326137
LinkDB
Position
Unknown
AA seq 100 aa
MNEEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ
QIVDKTIINADKDGDGRISFEEFCIVVGGLDIHKKMVVDV
NT seq 303 nt   +upstreamnt  +downstreamnt
atgaacgaagagttcattgaaggcgtctctcagttcagtgtcaagggtgacaaggagcag
aagctccgctttgcgttcaggatttatgacatggataaggatggctacatatccaacggt
gagctgttccaggtgctgaagatgatggtagggaataacctgaaggacacccagctgcag
cagatcgtcgacaaaaccatcatcaacgcagacaaggatggggacgggaggatatctttc
gaggagttctgcattgtggttggtggcttagacattcacaaaaagatggtggtggatgtg
tga

KEGG   Sinocyclocheilus anshuiensis: 107676745
Entry
107676745         CDS       T04917                                 

Gene name
ppp3ca
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107676745 (ppp3ca)
   04310 Wnt signaling pathway
    107676745 (ppp3ca)
   04370 VEGF signaling pathway
    107676745 (ppp3ca)
   04020 Calcium signaling pathway
    107676745 (ppp3ca)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107676745 (ppp3ca)
   04218 Cellular senescence
    107676745 (ppp3ca)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107676745 (ppp3ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107676745 (ppp3ca)
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107676745 (ppp3ca)
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107676745 (ppp3ca)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107676745
NCBI-ProteinID: XP_016326894
LinkDB
Position
Unknown
AA seq 516 aa
MHSVPFPPSHRLTVKEVFDSEGKPKVDVLKAHLTKEGRVEESVALQLIGEGAAILRSEKN
LLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPASTRYLFLGDYVDRGYFSIECVLYLWALK
ILYPKTLFLLRGNHECRHLTEYFTFKQECRIKYSERVYDACMDAFDCLPLAALMNQQFLC
VHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKTQEHFTHNTVRGCS
YFYSYPAACDFLQHNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNN
KAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSNDEL
TTDEEIDGQLIYGPKKGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPT
GMLPSGVLSGGKEKLQNETAATIEAIETDKAIKGFSPQHKISSFEEAKGLDRINERMPPR
RDAIPCDASLNSLNKALSSETNGTEGKACSGSGNIQ
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgcactctgtcccgtttcccccaagccaccgactgactgtgaaagaggtgtttgacagt
gagggcaaacccaaagtagatgttctgaaggcccacctcactaaagaggggcgtgtggaa
gagagtgttgcacttcaattaattggcgagggagcggcaatcctccgttcggagaagaac
ctcctggacatagaagccccagtgacagtttgtggagacattcatgggcagttctttgac
ttgatgaagctctttgaggtaggagggtctccagccagcacacgataccttttcctgggt
gattatgtggacagaggatatttcagtattgaatgtgtactgtacctatgggccttaaaa
atcctttatcccaagacactgtttttgctgcgtgggaaccacgaatgtagacatttaaca
gagtatttcacttttaaacaggaatgtagaattaaatattcagagcgggtgtatgatgcg
tgtatggatgcctttgactgtcttcccctggcagcgctgatgaaccagcagttcttgtgt
gtgcacggtggattgtcccccgaaatcacaaaccttgatgacatcaggaaattagacaga
ttcaaagagcctcccgcatatggaccaatgtgtgacttgctttggtcggacccactggag
gactttggcaacgagaaaacccaggaacatttcacacacaacacagtgagaggctgctcc
tatttctacagttatcctgctgcgtgtgactttctgcaacacaacaacttattatctatc
atacgagcccatgaagcacaggatgctgggtatcgcatgtacagaaagagtcaaactaca
ggcttcccctctctcatcactatcttctcagctcccaactacttagatgtctacaataac
aaagctgctgtcctgaaatatgagaataatgtcatgaacattcggcagtttaactgttct
cctcatccttactggctgcctaacttcatggatgtcttcacttggtccttgccttttgtt
ggggagaaagtgactgagatgcttgtgaatgtcttgagcatctgctccaatgatgagctg
accactgatgaagagatagatggacagctaatatatgggcccaagaaaggtgccacggct
tctgcacgcaaggaggtaatccgaaacaagatccgtgccattggaaagatggctcgggtt
ttctcagttcttcgagaggagagtgagagcgttttgacgttgaagggtctcactccaact
ggcatgctacccagtggcgttctgtctggaggcaaagagaaactccagaatgaaactgca
gctactattgaggctatagagacagataaagcaattaaaggcttctcacctcagcacaag
atcagcagctttgaggaggctaaagggctggaccgcatcaatgagcgaatgccaccccgc
cgtgacgccataccctgtgacgccagcctcaactcccttaataaggctctgtcatcagag
accaatggcaccgagggcaaggcctgcagcggcagcggtaatatccagtga

KEGG   Sinocyclocheilus anshuiensis: 107678020
Entry
107678020         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107678020
   04310 Wnt signaling pathway
    107678020
   04370 VEGF signaling pathway
    107678020
   04020 Calcium signaling pathway
    107678020
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107678020
   04218 Cellular senescence
    107678020
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107678020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107678020
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107678020
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107678020
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107678020
NCBI-ProteinID: XP_016328602
UniProt: A0A671RBV3
LinkDB
Position
Unknown
AA seq 511 aa
MSGKEQNKQSTTERLVKAVPYPPTTRLTMKELYEDGKPKVELLKSHLVKEGRLEEDAALR
IINDGASILRHEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPHNTRYLFLGDYVDRG
YFSIECVLYLWALKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFD
CLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEK
SSEHFCHNSVRGCSYFYSYPAVCDFLMNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLI
TIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTE
MLVNVLNICSDDELMSEGDDTCEGGTPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQ
LKGLTPTGTLPLGVLSGGRQTLQSATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERM
PPRKDSMQPDGTANSINAANSPDKNGTNAQA
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtcggggaaggagcagaataaacaatccaccaccgaacggctcgtcaaagcagtgccg
taccctcccacaacgcggctcaccatgaaagagctgtacgaggacggcaagcccaaggtg
gagcttttgaagagccacctggtgaaagaggggcgcctggaggaagacgcggccctacgc
atcatcaacgatggcgccagcatcctccgccatgagaaatgcatgctggaagtggaggcc
cccatcacagtgtgtggagatgtccatgggcagttttttgacctgatgaagctctttgag
gtggggggttccccgcacaatacacgctatctatttttgggagactatgtggatcgaggc
tatttcagtattgagtgtgtgctctatctgtgggccctgaagatcaaccacccgaccacc
ctcttcctcctcagaggcaaccacgagtgtcggcatctcacagagtacttcacctttaaa
caagaatgcaagattaagtactcggagcgtgtgtatgacgcctgcatggaggcctttgac
tgccttcccctggccgctctgctcaaccagcagttcctgtgcgttcacggaggcctgtcc
cccgagatcacctgcctcgacgacatccggaaattagacaggtttaaagagcctccagct
ttcgggccgatgtgcgacctgctgtggtctgaccctggcgaggactatggcagcgaaaag
agctcggagcacttttgtcacaacagtgtgagaggatgttcctatttctacagttaccct
gcagtgtgtgactttctgatgaataataacttgttgtcagttataagagcacatgaagcc
caagacgcaggatatcgaatgtacagaaaaagtcagacgacaggcttcccctctttaatc
acaatcttctctgcaccaaactacttagatgtgtataacaataaagctgctgtgttgaaa
tacgagaacaacgtcatgaacatacggcagttcaattgctctcctcacccgtactggctg
cccaacttcatggacgtgttcacgtggtcactgcccttcgttggggagaaagtaacagag
atgctggtcaacgtgttaaacatctgctcagatgatgagctcatgtcagagggagacgac
acatgtgaaggtggcaccccggcagtccgcaaggaggtgatccgaaataagattcgtgcc
attggcaagatggccagagttttctctgttcttagagaggagaatgagagtgtgttgcag
ttaaagggcttgacccccactgggacgttgcctctgggtgtgctatcaggaggcagacag
actctacagagcgccaccgtagaagcagaggaagcacgagccatccaaggcttcaaccct
caacacaagatccaaagcttcgaggaagcacgcggactggaccggataaacgagcgaatg
cctcctcgcaaggacagcatgcagccagacggcactgccaactccatcaacgcagccaat
tcccccgacaagaacggcaccaacgcacaggcgtag

KEGG   Sinocyclocheilus anshuiensis: 107680167
Entry
107680167         CDS       T04917                                 

Definition
(RefSeq) calcineurin subunit B type 1-like isoform X1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107680167
   04310 Wnt signaling pathway
    107680167
   04370 VEGF signaling pathway
    107680167
   04020 Calcium signaling pathway
    107680167
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107680167
   04218 Cellular senescence
    107680167
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107680167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107680167
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107680167
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107680167
NCBI-ProteinID: XP_016331434
LinkDB
Position
Unknown
AA seq 185 aa
MALRYGAMGKPLCVVTRARPAAAKDPVTGFDADEIKRLGKRFKKLDLDNSGSLSVEEFMS
LPELQQNPLVQRVIEIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDG
YISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKK
MVVDV
NT seq 558 nt   +upstreamnt  +downstreamnt
atggctcttcggtacggtgcgatgggcaaacctctgtgtgtggtgacccgcgcaaggcca
gcggcagccaaggatcccgtcacgggattcgatgctgatgagattaaaaggctgggaaag
aggtttaagaaactcgacctagataactctggatccctcagcgtggaggagttcatgtcc
ttgcccgagttacagcagaatccactggtgcagagagtcatcgagatattcgacacggat
ggcaacggagaggtggacttcaaagagttcatagagggcgtttctcagttcagtgtgaag
ggcgataaggagcagaaactgcgcttcgcttttaggatctatgacatggacaaggacggc
tacatttccaacggagagctgttccaggtgctgaagatgatggtgggcaacaatctgaag
gacactcagctgcagcagatagtggacaagaccatcatcaacgcagacaaggacggcgat
gggagaatatccttcgaggagttctgtgctgtcgtcggaggcctggatatacacaagaag
atggtggtggatgtgtga

KEGG   Sinocyclocheilus anshuiensis: 107680292
Entry
107680292         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107680292
   04310 Wnt signaling pathway
    107680292
   04370 VEGF signaling pathway
    107680292
   04020 Calcium signaling pathway
    107680292
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107680292
   04218 Cellular senescence
    107680292
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107680292
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107680292
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107680292
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107680292
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107680292
NCBI-ProteinID: XP_016331615
LinkDB
Position
Unknown
AA seq 522 aa
MRMSSTDIMGLNLTDRLIKSVPFPLSHRLTMREVFDCEGKPRVDLLKAHLTKEGRLEEPV
ALRIINEGAAILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYV
DRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDVCMD
AFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFG
NEKSQDYFSHNSVRGCSYFYSYPAVCEFLQTNNLLSVIRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESEN
VLTLKGLTPTGMLPSGVLSGGKQTLQSATIEAIEAVETVEDGEAIRGFSPQHKINSFEEA
KGLDRINERMPPRRDVVNSVGLSMCKMNMAESNGTDDNSNIQ
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagaatgtccagcacagacatcatgggtttaaaccttaccgaccgcctaatcaaatcg
gtgccgttcccgctgagccacaggttaaccatgcgagaggtgttcgactgtgaggggaaa
ccgcgtgtggacctgctgaaggctcacctcactaaagagggtcgcttggaggagcctgtc
gccctgcgtatcatcaatgagggggccgccatcctccgccaggagaagaccatgctggac
atagaggcccctgtcacagtgtgcggggatattcacgggcagttcttcgacctgatgaag
ttatttgaggttggcgggtctcctgcgacaacgaggtacttgtttctaggggactatgtg
gaccgagggtacttcagtattgagtgtgtcctttacctctggtcgctgaaaatcctctac
ccaaagacgctgtttctgctgcggggaaaccatgaatgtagacatttgactgaatatttc
actttcaaacaagaatgtaaaatcaaatactcggagcaggtgtatgatgtgtgcatggat
gcattcgactgtctgcctctggctgctctgatgaatcagcagtttttgtgtgttcatggt
ggcctgtctccagagatacacacgttagacgacatcaagaagctggacaggttcaaggaa
ccgccagcgtttggccccatgtgtgatctgctgtggtccgacccgctggaggacttcggc
aatgaaaagagtcaagattacttcagccacaacagtgtccgtggatgctcctacttctac
agctatcctgcggtgtgtgagtttttacagaccaacaacttactgtctgtcatcagagca
catgaggcgcaggacgcgggttaccgtatgtacaggaagagtcagactacaggttttccg
tctctcatcaccatcttttctgctccaaactacctggacgtttacaacaacaaagcggcc
gtgcttaaatacgagaacaacgtaatgaacatacgacagttcaactgctcgccacatccg
tactggctgcccaacttcatggacgtcttcacctggtctcttccgttcgttggggagaaa
gtgacagaaatgttggtgaatgtcctcagtatctgctctgatgatgagcttatgaacgac
ggagatgagatctttgatgctaacgctgcggctgcccgtaaagaggttatcagaaacaag
atccgtgccatcggcaaaatggccaaaatgttttcagtcttgcgagaggagagtgagaat
gtgttaaccctgaaaggtctgacccccaccggcatgctgccgagcggcgtactgtctgga
ggaaaacaaaccttgcagagcgctaccatcgaggccattgaagccgtggagacggttgag
gatggagaagccatccgtggcttttctccacagcacaagatcaacagtttcgaggaggcg
aagggtctggaccgcataaacgagcgaatgccgcctcgccgagacgtggtcaacagcgtg
gggctgtcaatgtgcaagatgaacatggccgaatccaacggcacggacgacaacagcaat
atccagtga

KEGG   Sinocyclocheilus anshuiensis: 107684296
Entry
107684296         CDS       T04917                                 

Definition
(RefSeq) calcineurin subunit B type 1-like
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107684296
   04310 Wnt signaling pathway
    107684296
   04370 VEGF signaling pathway
    107684296
   04020 Calcium signaling pathway
    107684296
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107684296
   04218 Cellular senescence
    107684296
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107684296
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107684296
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107684296
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9
Other DBs
NCBI-GeneID: 107684296
NCBI-ProteinID: XP_016336019
LinkDB
Position
Unknown
AA seq 237 aa
MCCSNAPPPSARLAPSLSFSLQSPPPPQPTASYPSAADLPKPLQSIRHPSTESPRTKSER
RATATSSPRKITVTESARSVPRDSAQGEDNPGDRMGNEASYPLEMCSHFDADEIKRLGKR
FKKLDLDNSGSLSVSVFFLAEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELF
QVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCIVVGGLDIHKKMVVDV
NT seq 714 nt   +upstreamnt  +downstreamnt
atgtgctgttctaatgcccctcccccctccgctcggctcgctccctccctctctttctct
ctccagtctccaccaccacctcaacccactgcctcttacccctccgctgcggacctaccg
aagccactgcagtcaatccgtcatccgtcgactgaaagcccgaggacaaaatccgagcga
cgcgctactgcgacttcctcgcccagaaaaataaccgtcaccgagagcgcccgttcagtt
ccgcgagattctgcgcaaggcgaagacaaccccggcgacagaatgggaaatgaggcgagt
tatcctttggagatgtgctcacactttgatgctgatgagattaaaagactaggaaagcgg
tttaagaaactcgacctggataactcgggttctctcagcgtttccgtcttttttcttgca
gagttcattgaaggcgtctctcagttcagcgtcaaaggcgacaaggagcagaagctccgc
tttgcgttcaggatttatgacatggataaggatggctacatatccaacggtgagctgttc
caggtgctgaagatgatggtagggaataacctgaaggacacccagctgcagcagatcgtc
gacaaaaccatcatcaacgcagacaaggatggggacgggaggatatctttcgaggagttc
tgcattgtggttggtggcttagacattcacaaaaagatggtggtggacgtgtga

KEGG   Sinocyclocheilus anshuiensis: 107684711
Entry
107684711         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107684711
   04310 Wnt signaling pathway
    107684711
   04370 VEGF signaling pathway
    107684711
   04020 Calcium signaling pathway
    107684711
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107684711
   04218 Cellular senescence
    107684711
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107684711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107684711
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107684711
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107684711
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107684711
NCBI-ProteinID: XP_016336532
LinkDB
Position
Unknown
AA seq 471 aa
MKMSNADMVLNSTDRVVKSVPFPLSHRLTMKEVFDCEGKPRVDLLKAHLTKEGRVEETVA
LRIVNEGASILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVD
RGYFSIECVLYLWSLKMLYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMGA
FDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGN
EKSQEYFSHNTVRGCSYFYSYPAVCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS
LITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKV
TEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENV
LTLKGLTPTGMLPSGVLSGGKQTLQSATTEAIEAIETDEDGEGNSRTCIWA
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgaagatgtctaacgctgacatggtcttgaactccaccgatcgggtagtgaaatccgtt
cccttccccctgagtcatcgtctcaccatgaaggaggtgtttgactgtgaggggaaacca
agggtggatctactgaaagcccacctcactaaagagggccgagtggaggagaccgtggcc
ctccgaatcgtaaacgaaggggcctctatcttacgacaggagaagaccatgctggacata
gaggcacctgtcacagtgtgcggtgacatccatgggcagttctttgacctgatgaaactg
tttgaggtgggaggctctccagccaccacacgatacctcttcctgggcgactatgtggac
cggggttacttcagtattgagtgtgttctgtacctctggtcactgaaaatgctctaccca
aagacgctatttttactgagaggaaatcatgaatgtagacatttgacagaatatttcacc
ttcaaacaagaatgtaaaatcaagtattcagagcaggtttacgatgcctgtatgggcgcg
tttgactgtctgcccttggcagctctcatgaaccagcagttcctgtgcgtccacggtggc
ctgtccccagaaatacagaccttagatgacataaagaagttggaccggtttaaggagccc
ccagcattcgggcctatgtgtgatttgctttggtccgatcccctggaggacttcggcaat
gaaaagagccaagagtactttagccacaacacagtcagaggatgctcatacttctacagt
tatccggctgtctgtgacttcctacagaataataacttgttatcaatcatccgagcacac
gaagcacaagatgcagggtatcggatgtacaggaagagtcagactactggcttcccttcc
ctaattaccatcttctctgcaccaaactaccttgatgtttacaacaataaagctgctgtt
ctgaagtatgagaacaatgtaatgaacatccggcagtttaactgctctcctcatccttac
tggctgccaaatttcatggatgtctttacctggtcacttccatttgtgggggagaaagtc
acggagatgctggtaaatgtgttgagcatctgttctgacgatgagctgatgaatgatgga
gacgagatctttgacgccaatgcagcagctgctcggaaagaggtgattaggaacaagatc
cgtgccattgggaagatggccaagatgttctctgtgctcagagaggagagtgagaatgtg
ttgaccctgaagggcctgacccctaccggcatgctgcccagcggggtgctttctggaggc
aagcagactctgcagagtgcaaccaccgaagccattgaagccatcgagacggatgaagac
ggagaaggtaattccaggacatgtatctgggcataa

KEGG   Sinocyclocheilus anshuiensis: 107688381
Entry
107688381         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107688381
   04310 Wnt signaling pathway
    107688381
   04370 VEGF signaling pathway
    107688381
   04020 Calcium signaling pathway
    107688381
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107688381
   04218 Cellular senescence
    107688381
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107688381
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107688381
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107688381
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107688381
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107688381
NCBI-ProteinID: XP_016341529
LinkDB
Position
Unknown
AA seq 467 aa
MSGKEQNKQSTTERLVKAVPYPPTTRLTMKELYEDGKPKVELLKSHLVKEGRLEEDAALR
IINDGANILRHEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPHNTRYLFLGDYVDRG
YFSIECVLYLWALKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDSCMEAFD
CLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEK
SSEHFCHNSVRGCSYFYSYPAVCDFLMNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLF
TIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTE
MLVNVLNICSDDELMSEGDDTCEGGTPAVRKEALTLFLSRLIPHLCLSHAIQGFNPQHKI
QSFEEARGLDRINERMPPRKDTMQPDGTANSINAANSPDKNGTNAQA
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcggggaaggagcagaataaacaatccaccaccgaacggctcgtcaaagcagtgccg
taccctcccacgacgcggctcaccatgaaagagctgtatgaggacggcaagcccaaggtg
gagcttttgaagagccacctggtgaaagagggccgcctggaggaagatgcggccctacgc
atcatcaatgacggcgccaacatcctccgccacgagaaatgcatgctggaagtggaggcc
cccatcacagtgtgcggagatgtccatgggcagttttttgacctgatgaagctctttgag
gtggggggttccccacacaacacacgctatctatttttgggagactatgtggatcgaggc
tatttcagtattgagtgtgtgctctatctgtgggccttgaagattaaccatccgaccacc
ctcttcctcctcagaggcaaccacgagtgtcggcatctcacggagtacttcacctttaaa
caagaatgcaagattaagtactcggagcgcgtgtatgattcctgcatggaggcctttgac
tgccttcccctggccgctctgctcaaccagcagttcctgtgcgttcacggaggcctgtcc
cccgagatcacctgcctcgacgacatccggaaattagacaggtttaaagagccgccagct
ttcgggccgatgtgcgacctgctgtggtctgaccctggcgaggactacggcagcgaaaag
agctcggagcacttttgtcacaacagtgtgagaggatgttcctatttctacagttaccct
gcagtatgtgactttctgatgaataacaacttgttgtcagttataagagcacatgaagcc
caagatgcagggtatcgaatgtacagaaaaagtcagacgacaggcttcccctctttattc
acaattttctctgcaccaaactacttagatgtgtataacaataaagctgctgtgttgaaa
tacgagaacaacgtcatgaacatccggcagttcaattgctctcctcacccatactggctg
cccaacttcatggacgtgttcacgtggtcactgcccttcgtcggggagaaagtaacagag
atgctagtcaacgtgttaaacatctgctcagatgatgagctcatgtcagagggagatgac
acatgtgaaggtggcaccccggcagtccgcaaggaggcactcactttgtttctgtcccgc
ctcatcccgcatctctgcctctctcacgccatccaaggcttcaaccctcaacacaagatc
caaagcttcgaggaagcacgcggactggaccggataaacgagcgaatgcctccacgcaag
gacaccatgcagcctgacggcactgccaactccatcaacgcagccaattcccccgacaag
aacggcaccaacgcacaggcgtag

KEGG   Sinocyclocheilus anshuiensis: 107693681
Entry
107693681         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107693681
   04310 Wnt signaling pathway
    107693681
   04370 VEGF signaling pathway
    107693681
   04020 Calcium signaling pathway
    107693681
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107693681
   04218 Cellular senescence
    107693681
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107693681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107693681
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107693681
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107693681
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107693681
NCBI-ProteinID: XP_016348635
LinkDB
Position
Unknown
AA seq 521 aa
MKMSNADMVLNSTDRVVKSVPFPLSHRLTMKEVFDCEGKPRVDLLKAHLTKEGRVEETVA
LRIINEGASILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVD
RGYFSIECVLYLWSLKMLYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMGA
FDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGN
EKSQEYFSHNSVRGCSYFYSYPAVCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS
LITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKV
TEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENV
LTLKGLTPTGMLPSGVLSGGKQTIQSATVEAIEAIETEEDGEAIRGFSPQHKINSFEEAK
GLDRINERMPPRKDGVNHVGHSMGKMNMSETNGTDDNSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaagatgtccaacgctgacatggtcttgaactccaccgatcgggtagtgaaatccgtt
cccttccccctgagtcaccgcctcaccatgaaggaggtgtttgactgtgaggggaaacca
agggtggatctactgaaagcccacctcactaaagagggccgagtggaggagaccgtggcc
cttcgaatcataaatgaaggggcctctatcttacgccaggagaagaccatgctggacata
gaggcacctgtcacagtgtgcggtgacatccatgggcagtttttcgacctgatgaaactg
tttgaggtgggaggctctccagccacgacacgatacctcttcctgggtgactatgtggac
cggggttacttcagtatcgagtgtgttctgtacctctggtcactgaaaatgctctaccca
aagacgctatttttactgagaggaaatcatgaatgtagacatttgacagaatatttcacc
ttcaaacaagaatgtaaaatcaagtattcagagcaggtttacgatgcctgtatgggcgca
tttgactgtctgcccttggcagctctcatgaaccagcagttcctgtgcgtccacggtggc
ctgtccccagaaatacagaccttagacgacataaagaagttggaccggtttaaggagccc
ccagcattcgggcctatgtgtgatttgctttggtccgatcccttggaggacttcggcaat
gaaaaaagccaagagtactttagccataactcagtcagaggatgctcatatttctacagt
tatccggctgtctgtgacttcctacagaataataacttgttatcaatcattcgagcacat
gaagcacaggatgcagggtaccggatgtacaggaagagtcagaccactggcttcccttcc
ctaattaccattttctctgcgccaaactaccttgatgtttacaataataaagctgccgtc
ctgaagtatgagaacaatgtaatgaacatccggcagtttaactgctcccctcatccttac
tggctgccaaatttcatggatgtcttcacctggtcgctgccatttgtgggggagaaagtc
acggagatgctggtaaatgtgttgagcatctgttctgatgatgagctgatgaatgatgga
gacgagatctttgacgccaatgcagcagctgcccggaaagaggtgattagaaacaagatc
cgtgccattgggaagatggccaagatgttctccgtgctcagagaggagagtgagaatgtg
ttgaccctgaagggtctgacccctaccgggatgctccccagcggggtgctttctggaggc
aagcagactatacagagtgcaaccgtcgaagccattgaagccatcgagacggaagaagat
ggagaagccatccgcggcttctctccacagcacaagatcaacagcttcgaagaggctaaa
ggtctggaccgcatcaacgaacgcatgccgccccgcaaggatggagtcaaccacgtgggc
cactccatgggcaagatgaacatgtccgagaccaacggcaccgacgacaacagtaacatc
cagtga

KEGG   Sinocyclocheilus anshuiensis: 107699153
Entry
107699153         CDS       T04917                                 

Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107699153
   04310 Wnt signaling pathway
    107699153
   04370 VEGF signaling pathway
    107699153
   04020 Calcium signaling pathway
    107699153
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107699153
   04218 Cellular senescence
    107699153
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107699153
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107699153
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107699153
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107699153
NCBI-ProteinID: XP_016355824
UniProt: A0A671T6W5
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIE
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIVNADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcccctggaaatgtgctcgcatttcgatgctgatgagatt
aaaaggctgggaaagaggtttaagaaactcgacctagataactctggatccctcagcgtg
gaggagttcatgtccttgcccgagttacagcagaatccactggtgcagagagtcatcgag
atattcgacacggacggcaacggagaggtggacttcaaagagttcatagagggcgtctct
cagttcagtgtgaagggtgataaggagcagaaactgcgcttcgcttttaggatctatgac
atggacaaggacggctacatttccaacggagagctgttccaggtgctgaagatgatggtg
ggcaacaatctgaaggacactcagctgcagcagatagtagacaagaccatcgtcaacgca
gacaaggacggcgatgggagaatatccttcgaggagttctgtgctgttgtcggcggtctg
gatatacacaagaagatggtggtggatgtgtga

DBGET integrated database retrieval system