KEGG   Sinocyclocheilus anshuiensis: 107656774
Entry
107656774         CDS       T04917                                 

Definition
(RefSeq) transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04137  Mitophagy - animal
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh04623  Cytosolic DNA-sensing pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107656774
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107656774
  09143 Cell growth and death
   04210 Apoptosis
    107656774
   04218 Cellular senescence
    107656774
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107656774
   04621 NOD-like receptor signaling pathway
    107656774
   04622 RIG-I-like receptor signaling pathway
    107656774
   04623 Cytosolic DNA-sensing pathway
    107656774
   04625 C-type lectin receptor signaling pathway
    107656774
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107656774
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107656774
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107656774
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107656774
Transcription factors [BR:sanh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107656774
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107656774
NCBI-ProteinID: XP_016300202
LinkDB
Position
Unknown
AA seq 509 aa
MDGLFHQWGASPVAQGPPYVEIIEQPKARGMRFRYKCEGRSAGSIPGEKSNESTKTHPAI
KVHNYSGPLRVRISLVTKNQPYKPHPHELVGKECKHGYYEADLQERRIHSFQNLGIQCVK
KKDVGDAVSCRLQTQNNPFNSKESRLQWEKNYDLNAVRLCFQVSITLPSGELFPLEHVVS
QPIYDNRAPNTAELKICRVNRSSGSCRGGDEIFLLCDKVQKEDIEVRFFQDSWESKGSFS
QADVHRQVAIVLRTPPYRDANLTEPVRVKMQLRRPSDRELSEPLDFQYLPADPDEHRLME
KRKRTEGMLQNLKLSSIITGSSMPADRRPCSTAKRTLGVSKPTAACSLPAAASAGVSSFF
TPGPGQLFAQSPLRLDPPSSSCSGDPWKLLQSVTVDSQPKPPVPPVFSTVNLSDLQDFPP
SSFIPAEPPSAPQDAFPSCSDVDSINTEEFQALLGQSGSTWMSFPPSLLQSESAAVLDDL
EVLSSIDDERFMAIFSSTHQTDFLSGHPT
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggacggactgtttcaccagtggggagcgtccccggtggcccaaggccctccgtacgtg
gagataatcgagcagccgaaagcacgagggatgcgtttccgctataaatgcgagggtcga
tcggccggcagcatcccaggagagaagagcaacgagtccacaaaaacacaccccgccatc
aaggttcacaactacagcgggccgctgagagtgcggatctctctggtgaccaagaaccag
ccgtacaagccacacccacacgagctggtgggcaaagagtgcaaacacgggtattacgag
gcagacttacaggagcggcggatacacagtttccagaatctgggtattcagtgcgtgaag
aagaaggatgtgggagatgcagtttcctgtcgcctgcagacacagaacaaccccttcaat
agtaaggaatctcggttacagtgggagaaaaactacgatctgaacgcggtgcgcctgtgc
ttccaagtgtccatcacgctgcccagcggagagctgttccctctggagcacgtcgtgtct
cagcccatctatgataaccgagctcctaacacagccgagctcaagatctgccgcgtcaac
aggagctccggcagctgccgcggaggagacgagatcttcctgctgtgcgacaaagtgcag
aaggaggacatcgaggtgcgtttcttccaggactcgtgggagagcaagggctcgttctct
caggctgatgttcaccggcaggtggctatcgtgttgcgcacgcctccgtaccgcgacgct
aacctgacggagccggtgcgtgtgaagatgcagctgcgcaggccgtctgaccgcgagctc
agcgagccgctggacttccagtacctgcccgcagacccggatgagcacagactgatggag
aagcgcaagagaacagaggggatgctgcagaacctcaaactgagcagcatcatcacagga
tcctccatgcctgcagacagacggccgtgtagtacagctaaacgaacactaggcgtctct
aaacccacagccgcctgcagcctcccagcagcggcgtctgcaggtgtgtcctcgttcttc
actcctggcccggggcagctgttcgcccagagtccgctcagactggatccgccgagctcc
agctgcagcggcgacccgtggaagctcctgcagagtgtgacggtggactcccagcccaag
cctccggtcccgccggtcttctccacggtgaacctgtcggacctgcaggacttccccccg
agcagcttcatcccggcagagcccccgagcgccccgcaggacgccttccccagctgctcc
gacgtggacagcatcaacaccgaggagttccaggcgctgctgggccagagcggctccacc
tggatgtccttccctcccagcctcctccagagcgaaagcgcggctgtcctggacgacctg
gaggtgctcagctccatcgatgacgagcgcttcatggccatcttctccagcacacaccag
acggactttctgtccggacaccccacctaa

DBGET integrated database retrieval system