KEGG   Sinocyclocheilus anshuiensis: 107656920Help
Entry
107656920         CDS       T04917                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00020  Citrate cycle (TCA cycle)
sanh00190  Oxidative phosphorylation
sanh01100  Metabolic pathways
sanh01200  Carbon metabolism
Module
sanh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sanh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sanh_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107656920
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107656920
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107656920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 107656920
NCBI-ProteinID: XP_016300353
LinkDB All DBs
Position
Unknown
AA seq 278 aa AA seqDB search
MAAVCFSLSRCCAAGHRASSTAVRFAQTASAVQPRIKSFQIYRWDPDRAGDKPRMQTYEI
DLNTCGPMVLDALIKIKNEMDGTLTFRRSCREGICGSCAMNINGGNTLACLNKIDTNTSK
VSKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESRQGQQQYLQSVEDRQKLDGL
YECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLSQLQDPFSLYRC
HTIMNCTRTCPKGLNPGKAIAEIKKMMASYKEKKTASA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggtgtgtttctccttgagccgctgctgcgccgccggtcaccgagcctcgagc
acggcggtgcggttcgcgcagacggcgtccgcggttcagcccagaatcaagagcttccag
atctaccgctgggacccggaccgcgccggagacaagcctcgcatgcagacgtacgagatc
gacctgaacacctgcgggccgatggttctggacgcgctcatcaagatcaagaacgagatg
gacgggacgctgaccttcagacgctcctgcagagagggaatctgcgggtcttgcgcgatg
aatatcaacggtggaaacactctggcgtgtctgaacaagatcgacactaacaccagcaag
gtgtcgaagatctacccgctgccgcacatgtatgtggtcaaagacctggtgccggacatg
agcaacttctacgctcagtacaagtccatcgagccgtacctgaagaagaaggacgagtcc
agacagggacagcagcagtacctgcagagcgtggaggaccggcagaaactggacggtctg
tacgagtgtatcctctgcgcctgctgcagcaccagctgtccgagctactggtggaacgga
gacaagtatctgggtccagccgtcctcatgcaggcgtaccgctggatgatcgactctcgt
gatgattacactgaggagaggctctcccagctccaggaccccttctctctgtaccgctgt
cacaccatcatgaactgcaccagaacctgcccgaagggtttgaatccaggcaaagccatc
gccgagatcaagaagatgatggccagctacaaagagaagaagacggcgtcggcgtga

DBGET integrated database retrieval system