KEGG   Sinocyclocheilus anshuiensis: 107657430
Entry
107657430         CDS       T04917                                 

Definition
(RefSeq) transcriptional regulator Myc-B
  KO
K04377  Myc proto-oncogene protein
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04110  Cell cycle
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107657430
   04012 ErbB signaling pathway
    107657430
   04310 Wnt signaling pathway
    107657430
   04350 TGF-beta signaling pathway
    107657430
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107657430
   04218 Cellular senescence
    107657430
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107657430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107657430
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107657430
Transcription factors [BR:sanh03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107657430
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107657430
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 107657430
NCBI-ProteinID: XP_016300978
UniProt: A0A671QSI6
LinkDB
Position
Unknown
AA seq 390 aa
MPLNSSMAIKNYDYDYDSYQPYFYFDNEDEAFYNHQHGQPPAPSEDIWKKFELLPTPPLS
PSRRPSLSDPFPSTADQLEMVSEFLGDDVVNHSFICEADYSQSFLKSIIIQDCMWSGFSA
AAKLEKVVSERLASLQAARKESSRSDSVDGCRSSPNLSYLQDMSTPASQCIDPSVVFPFP
LTDSSKPSKPSSTPISTTLPLDTPPNSGSSSDSDSDDEEEEEIDVVTVEKRKSVRKPDAN
ATHQSPVVLKRCHVNIHQHNYAAQPSTRSEQPAVKRIKFESNIRVFKQIDHNRKCTSPRT
SDSEDNDKRRTHNVLERQRRNELKLSFFALRDVIPDVANNEKAAKVVILKKATECIATIQ
EDEQKLISLKEQLRRKCEHLKWRLEQLSSS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgctgaattcaagtatggcgattaaaaattacgattacgactacgactcctaccag
ccctatttctatttcgacaacgaggatgaggctttctataaccaccagcacggacagcca
ccggcgcccagtgaggatatatggaagaaatttgaactgctccccactccgccgctctcc
ccgagccggcgtccctcgctgtcagaccccttcccctccacggccgaccagctggaaatg
gtgtcggagtttctcggggacgacgtggtcaaccacagttttatttgcgaggcggactac
tcccagtcttttctgaagtcgattatcattcaggactgtatgtggagtggtttctccgcc
gcggctaaactggagaaggtggtgtcggagagattagcgtcgctccaggcggcgaggaaa
gagtcttccaggagcgactctgtggacggctgtcggtccagccctaacctcagctacctt
caggacatgagcacccctgcctcacagtgcattgacccatcagtggtgttccctttcccg
ctgactgacagctcaaagccgtctaaaccgtcatccacaccgatttccacaacactgcca
ctggatactccaccaaacagtgggagcagcagtgacagcgattccgatgacgaagaggag
gaggaaatcgacgttgtcacggtggaaaagagaaagtctgtgagaaagcctgacgcaaac
gcaacgcatcaaagccccgtcgtcctcaagcggtgccacgttaatattcaccaacacaat
tacgctgcgcagccatccacgcggagcgagcagcctgcggtcaagcggattaaattcgag
agtaacatccgggtgtttaaacaaattgaccacaaccgtaaatgcacgagtcccaggacg
tcggactctgaggataacgacaaacgcaggactcataacgtgctcgagcggcaacggcgg
aacgagctcaaactcagtttcttcgcgctgagagacgtgattcctgacgtggccaacaac
gagaaagctgccaaagtggtgatactcaagaaggcgacggagtgcatagcgaccatacaa
gaagatgaacaaaaactgatctcacttaaggagcaattaaggaggaaatgtgaacatttg
aaatggagacttgagcagctaagcagttcttaa

KEGG   Sinocyclocheilus anshuiensis: 107681468
Entry
107681468         CDS       T04917                                 

Definition
(RefSeq) transcriptional regulator Myc-1
  KO
K04377  Myc proto-oncogene protein
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04110  Cell cycle
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107681468
   04012 ErbB signaling pathway
    107681468
   04310 Wnt signaling pathway
    107681468
   04350 TGF-beta signaling pathway
    107681468
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107681468
   04218 Cellular senescence
    107681468
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107681468
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107681468
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107681468
Transcription factors [BR:sanh03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107681468
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107681468
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 107681468
NCBI-ProteinID: XP_016333263
LinkDB
Position
Unknown
AA seq 392 aa
MPVIASLAYKNYDYDYDSIQPYFYFDNDDEDFYHHQQGQTQPPAPSEDIWKKFELLPTPP
LSPSRRQSLSTAEQLEMVSEFLGDDVVNQSFICDADNSQSFIKSIIIQDCMWSGFSAAAN
LEKVVSERLASLHAARKELMSDSSSNRLNASYLQDMSTSASECIDPSVVFPYPLTESSKS
SKVAPSEPMLVLDTPPNSSSSSGSDSEEEEEEEEEEEEEEEEIDVVTVEKRQKRNETEVS
DSRYPSPLVLKRCHVSTHQHNYAAHPSMRHDQPAVKRLRLEASSNNSSRHVKQRKCTSPR
TSDSEDKDKRRTHNVLERQRRNELKLSFFALRDEIPEVANNEKAAKVVILKKAAECIHSM
QLDEKRLLSIKEQLRRKSEQLKHRLQLLRSSH
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgccggtgatagcgagtttggcgtataaaaactacgattacgactacgactccatccag
ccctatttctatttcgacaacgacgatgaggatttctatcaccatcagcaaggacagact
caacctccagctcccagcgaggacatatggaagaaattcgagctgctgcccacaccgccc
ctctcacccagccggagacagtcgctctccaccgccgaacagctggagatggtaagcgag
ttcctgggagacgacgtggtcaaccagagcttcatctgcgacgcggacaactcccagtcc
ttcatcaagtccatcatcatccaggactgcatgtggagcggcttttccgctgccgccaat
ttggagaaagtggtttctgagagactagcgtccctgcacgctgctaggaaagaactgatg
tctgacagcagctcaaatcgactcaatgcaagttatttgcaggatatgagcacctctgca
tcagaatgcatcgacccttctgtggtcttcccgtatcccctcacggagtccagcaaatcc
agcaaggttgctccatcagaacccatgcttgtcctggacactccacctaacagctccagc
agcagtggcagcgattctgaagaagaagaagaagaggaggaggaggaggaagaggaagag
gaagaaattgatgtggtgactgtggaaaagcgacagaaaagaaacgagacggaggtgtca
gattcgaggtaccccagtcccctggtgttgaagcgctgtcacgtctccacccaccagcac
aactatgccgcccacccttccatgcggcacgaccagccggctgtcaagaggctacgactg
gaggccagcagcaacaacagcagcaggcatgtgaaacaacgcaagtgcacgagtccccgg
acatcggattcagaggacaaagacaaacgcagaactcacaatgtgctggagcgccaacgc
agaaacgaactcaaactcagctttttcgcattacgggatgagatccctgaggttgcaaat
aacgagaaagccgctaaagtggttatcctaaaaaaggcggcagagtgcatccacagcatg
cagttggatgagaaaaggctgttgtccatcaaagaacagctgaggcgaaagagcgaacag
ttaaaacacaggctgcagctgctgcgaagttcacattaa

KEGG   Sinocyclocheilus anshuiensis: 107691431
Entry
107691431         CDS       T04917                                 

Definition
(RefSeq) transcriptional regulator Myc-2
  KO
K04377  Myc proto-oncogene protein
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04110  Cell cycle
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107691431
   04012 ErbB signaling pathway
    107691431
   04310 Wnt signaling pathway
    107691431
   04350 TGF-beta signaling pathway
    107691431
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107691431
   04218 Cellular senescence
    107691431
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107691431
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107691431
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107691431
Transcription factors [BR:sanh03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107691431
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107691431
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH NOA36 PAC1
Other DBs
NCBI-GeneID: 107691431
NCBI-ProteinID: XP_016345508
LinkDB
Position
Unknown
AA seq 410 aa
MPVSASLAYKNYDYDYDSIQPYFYFDNDDEDFYHHQQGQTQPPAPSEDIWKKFELLPTPP
LSPSRRQSLSTAEQLEMVSEFLGDDVVNQSFICDADYSQSFIKSIIIQDCMWSGFSAAAK
LEKVVSERLASLHAARKERMVSDSSSNRLNASYLQDLSTSASECIDPSVVFPYPLTESSK
SSKIAPSEPMLVLDTPPNSSSSSGSDSEDDEEEEEEEEEEEEEEEEEEEEEEEIDVVTVE
KRQKRNEAEVSDSRYPSPLVLKRCHVSTHQHNYAAHPSMRHDQPAVKRLRLEASSSSSNN
STSSSNRHGKQRKCTSPRTSDSEDNDKRRTHNVLERQRRNELKLSFFALRDEIPEVANNE
KAAKVVILKKATECIHSMQLDEQRLLSLKEQLRRKSEQLKHRLQQLRSSH
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccggtgagtgcgagtttggcgtataaaaactacgattacgactacgactccatccag
ccctatttctacttcgacaacgacgatgaggatttctatcaccatcagcaaggacagact
caacctccagctcccagcgaggacatttggaagaaattcgagctgctgcccacaccgccc
ctctctcccagccggaggcagtcgctctccaccgccgaacagctggagatggtcagcgag
ttcctgggagacgacgtggtcaaccagagcttcatctgcgacgcggactactcccagtcc
ttcatcaagtccattatcatccaggactgcatgtggagcggcttttccgccgctgccaag
ttggagaaagtggtttctgagagactggcgtccctgcatgctgctaggaaggaacggatg
gtgtctgacagcagctcaaatcgactcaatgcaagttatttgcaggatctgagcacctct
gcatcagaatgcatcgacccctctgtggtctttccgtatcccctcacggagtccagcaaa
tccagcaagattgctccatcggaacccatgcttgtcctggacactccacctaacagctcc
agcagcagtggcagtgattctgaagatgatgaagaagaagaggaggaggaggaggaggag
gaagaagaagaggaggaggaagaagaagaagaggaagaaattgatgtggtgactgtggaa
aagcgtcagaaaaggaacgaggcggaggtgtcggattcaaggtaccccagtcccctggtg
ttgaagcgctgtcacgtctccacccaccagcacaactatgccgcccacccttccatgcgg
cacgaccagccggctgtcaagaggctacgactggaggccagcagcagcagcagcaacaac
agcaccagcagcagcaacaggcatgggaagcaacgcaagtgcacgagtccccgaacatcg
gattctgaggacaatgacaaacgcaggactcacaatgtgctggagcgccaacgtagaaat
gaactcaaactcagctttttcgcactacgggatgagatccctgaggttgcaaataacgag
aaagctgctaaagttgttattctaaagaaggcgacagagtgcatccacagcatgcagttg
gatgagcaaaggttgctgtccctgaaagaacagctgaggcgaaagagcgaacagttaaaa
cacaggctgcagcagctgcggagttcacattaa

DBGET integrated database retrieval system