KEGG   Sinocyclocheilus anshuiensis: 107657672Help
Entry
107657672         CDS       T04917                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107657672
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sanh01002]
    107657672
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107657672
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     107657672
Peptidases [BR:sanh01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107657672
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107657672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 107657672
NCBI-ProteinID: XP_016301337
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MKALILLALFAVAYAAPLDEDDKIVGGFECTKNGVQYQVSLNSGYHFCGGSLITNRWVVS
AAHCYKSRVQVRLGEHNIDVTEGTEQFINSETVIRHPSYNSNTLDNDVMLIKLASTATLN
SYVQTISLPSSCASSGTNCLISGWGNMSASGSNYPSRLMCLWAPILSDTTCRNAYPGQIT
SNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQKNKPGVYAKVCNFTTWIR
NTINSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattcttctggctctgttcgctgtggcttacgccgctcctctggatgag
gatgataagatcgtcggcggatttgagtgtactaagaatggtgttcaataccaggtttcc
ctgaacagtggctaccacttttgcggtggctctctgatcaccaaccgatgggttgtgtct
gctgctcactgttacaagtcacgtgtccaggtgcgtctgggtgagcacaacattgacgtc
actgagggcaccgagcagttcatcaactccgaaacagtcattagacaccccagttacaac
agcaatactctggacaatgatgtcatgctgatcaagctggccagcaccgccactctgaac
agctacgttcagaccatttctctgccttcaagctgtgcttcatctggtaccaactgcctg
atctctggatggggaaacatgagcgcctccggaagcaactaccccagccgtctgatgtgc
ctgtgggctcctatcctgagtgacactacctgcagaaatgcctaccctggtcagatcacc
tccaacatgttctgtgctggctttatggagggaggcaaggactcctgccagggtgactct
ggtggcccagtggtgtgcaacaaccagctgcagggtattgtgtcctggggttacggctgt
gcccagaagaacaaacctggtgtctatgccaaggtctgcaacttcaccacctggatcaga
aacaccatcaactccaactaa

DBGET integrated database retrieval system