KEGG   Sinocyclocheilus anshuiensis: 107657696Help
Entry
107657696         CDS       T04917                                 

Definition
(RefSeq) B-cell lymphoma 3 protein homolog isoform X1
Organism
sanh  Sinocyclocheilus anshuiensis
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5
Motif
Other DBs
NCBI-GeneID: 107657696
NCBI-ProteinID: XP_016301386
LinkDB All DBs
Position
Unknown
AA seq 625 aa AA seqDB search
MTSGSNHTVRSVPLDLTNKTRERGSCAQTGDQGRPRPTPERQVEPEHNCSNEHGNLPSEP
QDCGDGSVSQTTQTDAVGVRGNRTLEGPKQTRTITPNAAGKPANSSISKLPPRKRPFPLD
VDHDHSGPRNDPPSPDPKVLKNPEAQIDTESQRIFCTFGHKPSVNDSRFVPHLTPYPGCP
YFQWPRQLPALESTDRLLADIAEATRQDEDGDTPLHIAVVKENYQLVSWLIEIYRRAHKD
MDVFNNLRQTPLHLAIITRQTILVKALLDAGADPGALDRNGQTALHLCCECGEADCLSVI
LRHYPQNPSPHLEIRNYEGLTPLHLAVQNGDKKLAKILLKSGAEINAGDNKSGRSPLVHA
VENNFTDMVIFLIEVHSGCDVNAQSYSGNTALHSACGRGHIEIVRVLLKNGADSSLKNNH
NDTAIMVAKNKKVSDVLRGRGTRSCTVKTSSNGSLSPGSSNHSPRMTPTYFTFSPHSPVA
PVLPRSQSADNISERQSPMNSNEKTLQMLPRTHHNVAVDNRAGYGMALHHFPYLLPSGYD
QIKPTVSYIQRRMLITDCPLYYPTGIQTPPYCSDAQIILLPSFPVPVTYGSPSQGAVNQS
RPSSRSSNQSDISTVSVNSEERSAS
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtggcagtaatcacactgtgcgatctgtgccactggatcttaccaacaaaacc
agagagcgtgggagctgcgcgcaaacgggagaccaaggtcgccctagacctactccagaa
agacaggtggaaccggagcacaattgcagcaatgaacacggaaatcttccatccgaacca
caggactgtggtgatggatcagtttcgcagactactcaaacagacgccgtgggtgtcagg
ggaaataggacgcttgagggtcccaagcaaacccgaactataacccctaacgcagcagga
aaaccggcaaattcatccatttccaaactcccgccaaggaaacgtcctttcccgctggat
gtggatcatgaccacagtggtccaagaaacgatccacctagcccggatccaaaagttttg
aagaaccccgaggctcagatagacacagaatcacagcggatattttgtacatttggacat
aaaccaagcgttaatgactcccggtttgtgccacacttaacaccatatccaggttgtcca
tatttccagtggcctcggcagcttcctgcactggagagcacagatcggctgctggcagat
attgctgaggcaacacgtcaagatgaagatggtgacacgcctcttcacattgctgttgtc
aaagagaattaccagttggtcagctggcttattgaaatatatcgacgggcccacaaagac
atggacgttttcaataacttaagacagacaccactgcacttggctataataacccgtcag
acgattttggtgaaagctctgctggatgcaggcgctgaccctggagctttggaccgtaac
ggacagactgcgctgcacttgtgctgcgagtgcggagaggccgattgcctgtctgtcatc
ctcagacactacccccaaaacccctcgccccatctggagatcaggaactatgagggtctg
acgcctctccacctggctgtgcagaatggagataaaaagttggcaaaaatcttattgaag
agtggagctgaaatcaacgctggggataataagagtggtcgaagtccactggttcatgct
gtagaaaacaactttactgacatggtcatctttctgatcgaggtgcatagtgggtgtgat
gtgaacgcacagtcttatagtgggaatacagcattgcacagtgcctgtggcagaggtcat
atagagattgtcagggtcttgctgaaaaatggagccgacagtagtctgaaaaacaaccat
aatgacactgccatcatggtcgcaaaaaacaaaaaagtatctgatgtgctgcgtgggaga
ggcactcgcagctgcactgtgaaaactagcagtaatggctctctgtcccctggcagctcc
aaccattctccccgaatgactcccacttacttcactttctccccacattctcctgtggct
ccagttttaccccgaagtcagtcagcagacaacatttcagaacgtcagtcaccgatgaac
agcaatgaaaaaacactgcaaatgttgccacggacacaccataatgtagcagtggacaac
agggcaggctacggaatggcactccatcatttcccatatctgttaccttctgggtacgac
caaattaagcccactgtctcttatatccagagaaggatgctaatcacagattgcccactt
tactatcccactggtattcaaacacctccatattgctcagatgcacagatcatcttactc
cccagtttccccgtgccggtcacatatggctctccttcacagggtgccgttaaccaatca
cggccatccagtcgcagcagtaaccaatcagacatctctactgtgagcgtaaacagtgaa
gaaagaagtgcgagttga

DBGET integrated database retrieval system