KEGG   Sinocyclocheilus anshuiensis: 107657982Help
Entry
107657982         CDS       T04917                                 

Definition
(RefSeq) protein deglycase DJ-1zDJ-1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sanh01002]
    107657982
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107657982
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     107657982
Peptidases [BR:sanh01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   107657982
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107657982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 107657982
NCBI-ProteinID: XP_016301826
LinkDB All DBs
Position
Unknown
AA seq 189 aa AA seqDB search
MAGKRALVILAKGAEEMETVIPVDVMRRAGIAVTVAGLAGKEPVQCSRDVMICPDSSLED
ARKQGPYDVILLPGGLLGAQNLSESPAVKEVLKDQEGRKGLIAAICAGPTALLAHGIAYG
STVTTHPGAKDKMMAGDHYKYSEARVQKDGNVITSRGPGTSFEFALTIVEELMGAEVAGQ
VKAPLILKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctgggaaaagagctctggtgattctggcgaagggcgcggaggagatggagacggtg
atcccggtggatgtcatgcgcagagcggggattgctgttacagtagcaggtctggcgggt
aaagagccagtgcagtgcagccgtgatgtcatgatctgccctgactccagcctggaagac
gcccgcaaacagggtccgtatgatgttatacttctgcctggaggtttgcttggagctcaa
aacctttctgagtctcccgctgtgaaagaggtgttgaaagaccaggagggcaggaagggt
ctgatcgctgcaatctgtgcaggcccgacggcactcttggcacacggtatcgcatatggc
agcacagttaccacccatccaggtgccaaggacaagatgatggctggtgatcattataaa
tattcagaggctcgagttcagaaggatggtaacgtgatcaccagcagagggccaggaacc
agctttgagtttgccttgactatagtggaggagctcatgggtgcagaggtcgctggccaa
gtcaaagccccactcatcctgaaagactga

DBGET integrated database retrieval system