KEGG   Sinocyclocheilus anshuiensis: 107658562
Entry
107658562         CDS       T04917                                 

Gene name
prkacb
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04340  Hedgehog signaling pathway
sanh04371  Apelin signaling pathway
sanh04530  Tight junction
sanh04540  Gap junction
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107658562 (prkacb)
   04310 Wnt signaling pathway
    107658562 (prkacb)
   04340 Hedgehog signaling pathway
    107658562 (prkacb)
   04371 Apelin signaling pathway
    107658562 (prkacb)
   04020 Calcium signaling pathway
    107658562 (prkacb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107658562 (prkacb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107658562 (prkacb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107658562 (prkacb)
   04540 Gap junction
    107658562 (prkacb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107658562 (prkacb)
   04912 GnRH signaling pathway
    107658562 (prkacb)
   04914 Progesterone-mediated oocyte maturation
    107658562 (prkacb)
   04916 Melanogenesis
    107658562 (prkacb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107658562 (prkacb)
   04270 Vascular smooth muscle contraction
    107658562 (prkacb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107658562 (prkacb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107658562 (prkacb)
   03036 Chromosome and associated proteins [BR:sanh03036]
    107658562 (prkacb)
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107658562 (prkacb)
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107658562 (prkacb)
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107658562 (prkacb)
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107658562 (prkacb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 107658562
NCBI-ProteinID: XP_016302640
UniProt: A0A671QWP4
LinkDB
Position
Unknown
AA seq 395 aa
MAQTKDPNFGQSSGPNSALQRLDTLASRFFYKYRKGHQEKGLENEGPHVTDYTVLWDATM
KEFFAQAKEDFSRKWDFQPQSTSCLDDFDRLKTLGTGSFGRVMLVKHRQLGRYYAMKILD
KEKVVKLKQIEHTLNEKKTLQAVSFPFLVKLGFAFKDHSNLYMVMEYIQGGEMFSHLRRI
GRFSEQNARFYAAQIVLTFEYLHALDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRT
WTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKV
RYPSHLSSDLKDLLHNLLQVDLTKRFGNLKNGVSDIKNHRWFATTDWITIFEKKIDAPII
PKCRGPGDTSNFDEYDEEDIRLSVTEKCTKEFLEF
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcccagacaaaagatccaaactttgggcagtcatcaggccctaactctgcccttcag
aggctggacacgttagctagccgatttttttacaaatatcgaaaagggcaccaggagaag
ggactagagaatgaggggccacatgtgacagactataccgttctttgggatgcaacaatg
aaagaattctttgcacaagccaaagaggatttctcgagaaaatgggactttcagccgcag
agcacatcgtgtctagatgactttgacagattgaaaactcttggcactggatcttttgga
agagtaatgctagtcaagcacagacagttgggacgatactacgctatgaagattctggac
aaagaaaaagtggtgaagcttaaacagatagaacacacattaaacgagaagaaaacatta
caagcagtgtcctttcctttccttgtgaagctggggttcgcttttaaggatcattcaaat
ttatacatggtcatggaatatatccaaggtggtgagatgttctcacatctgagacggatt
ggaagattcagtgagcagaacgcacggttctatgctgctcagattgttctgaccttcgag
tatcttcatgctctagacctcatctacagagaccttaaacctgaaaacttgctcatcgat
catcagggatacatccaggtaacagacttcggctttgccaaacgagtcaaaggcagaact
tggacgttgtgcggtacaccagagtacctggcaccagagatcattctcagcaagggctac
aacaaagctgttgactggtgggcattgggtgttctgatctatgaaatggctgctggatat
ccgcctttcttcgctgaccaacctattcagatctatgagaaaattgtatctggcaaggta
cgatacccttcacaccttagttcagacctgaaggatcttctgcacaatctgctgcaggtg
gacctcacaaaacgctttggcaatttgaaaaatggagtcagcgacataaaaaaccacaga
tggttcgctacaacagactggattacaatctttgagaagaagattgatgctcccatcata
ccaaagtgcagaggacctggagacacgagtaactttgatgagtacgacgaggaagacatc
cggttatctgtcacagagaaatgtacaaaagagttcttggagttttag

KEGG   Sinocyclocheilus anshuiensis: 107660409
Entry
107660409         CDS       T04917                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04340  Hedgehog signaling pathway
sanh04371  Apelin signaling pathway
sanh04530  Tight junction
sanh04540  Gap junction
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107660409
   04310 Wnt signaling pathway
    107660409
   04340 Hedgehog signaling pathway
    107660409
   04371 Apelin signaling pathway
    107660409
   04020 Calcium signaling pathway
    107660409
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107660409
  09143 Cell growth and death
   04114 Oocyte meiosis
    107660409
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107660409
   04540 Gap junction
    107660409
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107660409
   04912 GnRH signaling pathway
    107660409
   04914 Progesterone-mediated oocyte maturation
    107660409
   04916 Melanogenesis
    107660409
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107660409
   04270 Vascular smooth muscle contraction
    107660409
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107660409
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107660409
   03036 Chromosome and associated proteins [BR:sanh03036]
    107660409
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107660409
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107660409
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107660409
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107660409
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 107660409
NCBI-ProteinID: XP_016305191
LinkDB
Position
Unknown
AA seq 354 aa
MGNAATAKKGNELESETFVKEFLAKAKEDFLRKWESPPQSTTGLDDFDKLKTLGTGSFGR
VMLVKHKATDQFYAMKVLDKQKVVKLKQVEHTLNEKRILQAVSFPFLVRLEYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQ
HGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGILIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLRNGVNDIKNHKW
FATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEEDIRVSVTEKCGKEFSEF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggaaacgcagcgactgccaagaaaggcaatgaactggagagcgagacgtttgtgaaa
gagtttctagccaaagccaaagaagatttcttgagaaaatgggaatcaccaccacagagc
acaactggtttagatgacttcgacaaactaaagacgttgggcacgggctcttttgggaga
gtcatgctggttaaacacaaggctacagatcagttctatgccatgaaggttctggacaag
caaaaggtggtgaagttgaaacaagtggagcatacgctaaatgagaagagaatattacaa
gcagtatctttcccgttcctcgtcagattggaatatgcgttcaaggacaactctaatttg
tatatggtgatggagtatgtaccgggaggggagatgttctcacatcttagaagaatcggg
aggtttagtgaaccacatgcacggttttatgctgctcagattgtcctgactttcgagtac
ctccactcactagacctcatctacagagacctgaaacctgaaaacctactcattgaccag
catggatatatacaggtaacagactttggttttgcaaaaagagtaaaaggcagaacctgg
actttatgtggaactccagagtacttggcaccagagatcatcctcagcaagggatacaac
aaggctgtggactggtgggcccttggtatactcatatatgaaatggcagctggatatccc
ccattttttgcagaccagcctattcagatctatgagaaaattgtgtctggaaaggtacga
ttcccttcgcacttcagttcggatctgaaagatctgttgaggaatctgctgcaggtggac
ctgaccaagcgatacggcaacctgaggaatggtgtcaatgatatcaaaaaccacaaatgg
tttgccacaacggattggatagccatctatgagagaaaggtggaggcgccgttcatacca
aagtgccgaggtcctggagacacaagcaactttgatgactatgaagaggaagacattcgt
gtatctgttacagaaaaatgcggaaaggagttctccgagttttag

KEGG   Sinocyclocheilus anshuiensis: 107661836
Entry
107661836         CDS       T04917                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04340  Hedgehog signaling pathway
sanh04371  Apelin signaling pathway
sanh04530  Tight junction
sanh04540  Gap junction
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107661836
   04310 Wnt signaling pathway
    107661836
   04340 Hedgehog signaling pathway
    107661836
   04371 Apelin signaling pathway
    107661836
   04020 Calcium signaling pathway
    107661836
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107661836
  09143 Cell growth and death
   04114 Oocyte meiosis
    107661836
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107661836
   04540 Gap junction
    107661836
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107661836
   04912 GnRH signaling pathway
    107661836
   04914 Progesterone-mediated oocyte maturation
    107661836
   04916 Melanogenesis
    107661836
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107661836
   04270 Vascular smooth muscle contraction
    107661836
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107661836
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107661836
   03036 Chromosome and associated proteins [BR:sanh03036]
    107661836
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107661836
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107661836
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107661836
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107661836
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107661836
NCBI-ProteinID: XP_016307096
UniProt: A0A671MEM1
LinkDB
Position
Unknown
AA seq 382 aa
MCDRKSSKRHGGKWESRSSGGSVEGGGGGSSGGGEGGVEGPTLLVDVKEFLAKAKEEFLK
KWENPAQNTASLDHFERLKTLGTGSFGRVMLVKHKESGQHFAMKILDKQKVVKLKQIEHT
LNEKRILQAVSFPFLVRLEHSFKDNTNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPE
IILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDL
LRNLLQVDLTKRFGNLKNGVNDIKGHKWFATTDWIAIYQKKVEAPFIPKCKGPGDTSNFD
DYEEEEIRVSFSEKCGKEFAEF
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgtgtgaccgaaaaagctcgaagaggcatggtgggaagtgggaatctcgttcttcagga
ggatcagtggagggaggagggggaggtagtagtggtggtggtgaaggaggagtggagggt
cccacgctcctagtggatgttaaggagtttcttgctaaagccaaagaagagttcctaaag
aaatgggagaacccagcacagaatactgcatctctggaccattttgagaggttgaagact
ctaggcactggctcgtttggacgagtcatgctagtcaagcacaaagagtcaggccagcat
tttgccatgaagatcctcgacaaacagaaggtggttaaactgaaacagatagaacacaca
ctgaatgagaaacgcatcctgcaggccgtcagcttcccattccttgtgcgattggagcac
tcgttcaaggacaatactaacctgtatatggtaatggagtatgttcctggaggagagatg
ttctctcacttacgtagaatcggacggtttagtgagcctcatgcccgattctacgccgcc
cagatagttctgacctttgaataccttcactcacttgatctaatctaccgagatctgaag
cctgaaaacctgctcatagaccagcagggctacatacaggtaacagattttggatttgct
aaacgtgtaaagggcaggacctggacactgtgtggcacacccgagtacctggcgccagaa
atcatcctcagtaaaggttataataaagcagtggactggtgggctctgggagtgctgatc
tatgaaatggctgccggttaccctccgttctttgccgaccagcccatccagatctacgag
aagattgtttctgggaaggttcgcttcccctcacattttagctctgacctgaaggacctg
ctgaggaacctgctgcaggtagatctgacgaagcgcttcggtaacctcaagaacggcgtc
aacgacatcaagggccacaaatggtttgcaaccaccgactggattgcaatctaccagaag
aaggtggaagcccccttcatccctaagtgcaaaggccccggtgacaccagcaactttgac
gactacgaggaagaagaaatccgggtctctttctcagagaaatgtggaaaggagtttgct
gaattctag

KEGG   Sinocyclocheilus anshuiensis: 107669012
Entry
107669012         CDS       T04917                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04340  Hedgehog signaling pathway
sanh04371  Apelin signaling pathway
sanh04530  Tight junction
sanh04540  Gap junction
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107669012
   04310 Wnt signaling pathway
    107669012
   04340 Hedgehog signaling pathway
    107669012
   04371 Apelin signaling pathway
    107669012
   04020 Calcium signaling pathway
    107669012
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107669012
  09143 Cell growth and death
   04114 Oocyte meiosis
    107669012
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107669012
   04540 Gap junction
    107669012
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107669012
   04912 GnRH signaling pathway
    107669012
   04914 Progesterone-mediated oocyte maturation
    107669012
   04916 Melanogenesis
    107669012
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107669012
   04270 Vascular smooth muscle contraction
    107669012
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107669012
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107669012
   03036 Chromosome and associated proteins [BR:sanh03036]
    107669012
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107669012
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107669012
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107669012
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107669012
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C APH
Other DBs
NCBI-GeneID: 107669012
NCBI-ProteinID: XP_016316587
UniProt: A0A671PAL0
LinkDB
Position
Unknown
AA seq 395 aa
MAQTKDPNFGQSSGTNSALQRLDMLASRFFYKYRKGHQEKGLENEGPHVSEYTILWDATM
KEFLAKAKEDLLRKWDCQPQSTSCLDDFDRLKTLGTGSFGRVMLVKHRQSGRYYAMKILD
KEKVVKLKQIEHTLNEKKILQAVSFPFLVKLEFAFKDHSNLYMVMEYIQGGEMFSHLRRI
GRFSEQNARFYAAQIVLTFEYLHALDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRT
WTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKV
RFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDLKNHRWFATTDWIAIYEKKIDAPII
PKCRGPGDTSNFDEYDEEDIRVSVTEKCTKEFLEF
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcccagacaaaagatccaaactttgggcagtcatcaggcaccaactctgcccttcag
aggctggacatgttagctagccgatttttttacaagtatcgaaaagggcaccaggagaaa
ggactagagaatgaggggccacatgtgtcagagtataccatcctttgggatgcaacaatg
aaagaattcttggcaaaagccaaagaggacttattgagaaaatgggactgtcagccacag
agcacatcgtgtctagatgactttgacagactgaaaactcttggcactggatcttttgga
agagtaatgctagtcaagcacagacagtcgggacgatactatgctatgaagattctggac
aaagaaaaagtggtgaagcttaaacagatagaacacacattaaacgagaagaaaatatta
caagcagtgtcatttcctttccttgtgaagctggagttcgcttttaaggatcattcaaat
ttatacatggtcatggagtatatccaaggtggtgagatgttctcacatctgagacggatt
ggaagattcagtgagcagaacgcacggttctatgctgctcagattgttctgaccttcgag
tatcttcatgctctagacctcatctacagagaccttaaacctgaaaacttgctcatcgat
catcagggatacatccaggtaacagactttggctttgccaaacgagtcaaaggcagaact
tggacgttgtgcggtacaccagagtacctggcaccagagatcattctcagcaagggctac
aacaaagctgttgactggtgggcattgggcgttctgatctacgaaatggctgctggatat
ccacctttcttcgctgatcaacctattcagatctatgagaaaattgtatctggcaaggta
cgatttccttcacactttagctcagacctgaaggatcttctgcgcaatctgctacaggtg
gacctcacaaaacgctttggcaatttgaaaaatggagtcagcgacctcaaaaaccacaga
tggttcgctacaacagactggattgcaatctatgagaagaagattgatgctcccatcata
ccaaagtgcagaggacctggagacacgagtaactttgatgagtacgacgaggaagacatc
cgggtatctgtcacagagaaatgtacaaaagagttcttggagttttag

KEGG   Sinocyclocheilus anshuiensis: 107670487
Entry
107670487         CDS       T04917                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04340  Hedgehog signaling pathway
sanh04371  Apelin signaling pathway
sanh04530  Tight junction
sanh04540  Gap junction
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107670487
   04310 Wnt signaling pathway
    107670487
   04340 Hedgehog signaling pathway
    107670487
   04371 Apelin signaling pathway
    107670487
   04020 Calcium signaling pathway
    107670487
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107670487
  09143 Cell growth and death
   04114 Oocyte meiosis
    107670487
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107670487
   04540 Gap junction
    107670487
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107670487
   04912 GnRH signaling pathway
    107670487
   04914 Progesterone-mediated oocyte maturation
    107670487
   04916 Melanogenesis
    107670487
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107670487
   04270 Vascular smooth muscle contraction
    107670487
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107670487
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107670487
   03036 Chromosome and associated proteins [BR:sanh03036]
    107670487
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107670487
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107670487
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107670487
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107670487
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107670487
NCBI-ProteinID: XP_016318589
UniProt: A0A671T7N9
LinkDB
Position
Unknown
AA seq 387 aa
MCDRKNSRRHGGKRESRSSGESRSSGGSVEGGGGGSSGGEGAVEGPTLLVDVKEFLAKAK
EDFLKKWENPAQNTASLDHFERLKTLGTGSFGRVMLVKHKELGQHFAMKILDKQKVVKLK
QIEHTLNEKRILQAVSFPFLVRLEHSFKDNTNLYMVMEYVPGGEMFSHLRRIGRFSEPHA
RFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPE
YLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSS
DLKDLLRNLLQVDLTKRFGNLKNGVNDIKGHKWFATTDWIAIYQKKVEAPFIPKCKGPGD
TSNFDDYEEEEIRVSFTEKCGKEFAEF
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgtgtgaccgaaaaaactccaggaggcatggtgggaagcgggaatctcgttcttcaggg
gaatctcgttcttcaggaggatcagtggagggaggagggggaggcagcagtggtggtgaa
ggagcagtggagggtcccacgctcctagtggacgttaaggagtttctcgctaaagccaaa
gaagatttcctaaagaaatgggagaacccagcacagaacactgcatctctggaccatttt
gagaggttgaagactctaggcactggctcgtttggacgagtcatgctagtcaagcacaaa
gaattaggccagcattttgccatgaagatcctcgataaacagaaggtggtgaaactgaaa
cagatcgaacacacgctgaatgagaaacgcatcctgcaggctgtcagcttcccgttcctt
gtgcgattggagcactcgttcaaggataatactaacctgtatatggtaatggagtatgtt
cctggaggagagatgttctctcacttacgtagaatcggccggttcagtgagcctcatgcc
cgattctacgccgcccagatagttctgacctttgaataccttcactcacttgatcttatc
taccgagatctgaagcctgaaaacctgctcatagaccagcagggctacatacaggtaaca
gattttggatttgctaaacgtgtaaagggcaggacctggacactgtgtggcacacctgag
tacctggcgccagaaatcatcctcagtaaaggttataataaagcagtggactggtgggct
ctgggtgtgctgatctatgaaatggctgccggttaccctccgttctttgccgaccagccc
atccagatctacgagaagattgtttctgggaaggttcgcttcccctcacactttagctct
gacctgaaggacctgctgagaaacctgctgcaggtagatctgacgaagcgcttcggtaac
ctcaagaacggcgtcaacgacatcaaaggccacaaatggtttgcaaccaccgactggatc
gcaatctaccagaagaaggtggaagcccccttcatacctaagtgcaaaggccccggcgac
accagcaactttgacgactacgaggaagaagaaatccgggtctctttcacagagaaatgt
ggaaaggagtttgctgaattctag

KEGG   Sinocyclocheilus anshuiensis: 107671753
Entry
107671753         CDS       T04917                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04340  Hedgehog signaling pathway
sanh04371  Apelin signaling pathway
sanh04530  Tight junction
sanh04540  Gap junction
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107671753
   04310 Wnt signaling pathway
    107671753
   04340 Hedgehog signaling pathway
    107671753
   04371 Apelin signaling pathway
    107671753
   04020 Calcium signaling pathway
    107671753
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107671753
  09143 Cell growth and death
   04114 Oocyte meiosis
    107671753
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107671753
   04540 Gap junction
    107671753
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107671753
   04912 GnRH signaling pathway
    107671753
   04914 Progesterone-mediated oocyte maturation
    107671753
   04916 Melanogenesis
    107671753
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107671753
   04270 Vascular smooth muscle contraction
    107671753
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107671753
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107671753
   03036 Chromosome and associated proteins [BR:sanh03036]
    107671753
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107671753
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107671753
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107671753
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107671753
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107671753
NCBI-ProteinID: XP_016320188
LinkDB
Position
Unknown
AA seq 314 aa
MGNTATAKKGNELESETFVKEFLAKAKEDFLRKWESPPQSTTGLDDFDRLKTLGTGSFGR
VMLVKHKATDQFYAMKVLDKQKVVKLKQVEHTLNEKRILQAVSFPFLVRLEYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQ
HGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLRNGVNDIKNHKW
FATADWIAIYERKV
NT seq 945 nt   +upstreamnt  +downstreamnt
atgggaaacacagctactgccaagaaaggcaatgaactggagagcgagacttttgtgaaa
gagtttctagccaaagccaaagaagatttcttgagaaaatgggaatcaccaccacagagc
acaactggtttagatgattttgacagactgaagacgttgggcacgggctcttttgggcga
gtcatgctggttaaacacaaggctacagatcagttctatgccatgaaagttctggacaaa
caaaaggtggtgaagttgaaacaagtagagcatacgctaaatgagaagagaatattacaa
gcagtatccttcccgttcctcgtcagattggaatatgccttcaaggacaactctaatttg
tatatggtgatggagtatgtaccaggaggggagatgttctcacatcttagaagaatcgga
aggtttagtgaaccacatgcacggttttatgctgcacaaattgtcctgaccttcgagtac
ctccactcactagacctcatctacagagacctgaaacctgaaaacctacttattgaccag
catggatatatacaggtaacagactttggttttgcaaaaagagtaaaaggcagaacctgg
acattatgtggaactccagagtacttggcaccagagatcatcctcagcaagggatacaac
aaggctgtggactggtgggcccttggtgttctcatatatgaaatggcagctggatatccc
ccgttttttgcagaccagcctattcagatctatgagaagattgtgtctggaaaggtacga
ttcccctcgcacttcagttccgatctgaaagatctgttgaggaatctgctgcaggtggac
ctgaccaagcgctacggcaacctaaggaatggtgtcaatgatattaaaaaccacaaatgg
tttgccacagcggattggatagccatctatgagagaaaggtatga

KEGG   Sinocyclocheilus anshuiensis: 107694605
Entry
107694605         CDS       T04917                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04340  Hedgehog signaling pathway
sanh04371  Apelin signaling pathway
sanh04530  Tight junction
sanh04540  Gap junction
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107694605
   04310 Wnt signaling pathway
    107694605
   04340 Hedgehog signaling pathway
    107694605
   04371 Apelin signaling pathway
    107694605
   04020 Calcium signaling pathway
    107694605
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107694605
  09143 Cell growth and death
   04114 Oocyte meiosis
    107694605
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107694605
   04540 Gap junction
    107694605
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107694605
   04912 GnRH signaling pathway
    107694605
   04914 Progesterone-mediated oocyte maturation
    107694605
   04916 Melanogenesis
    107694605
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107694605
   04270 Vascular smooth muscle contraction
    107694605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107694605
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107694605
   03036 Chromosome and associated proteins [BR:sanh03036]
    107694605
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107694605
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107694605
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107694605
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107694605
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107694605
NCBI-ProteinID: XP_016349784
LinkDB
Position
Unknown
AA seq 351 aa
MGNTPAAKRGNEMESVKEFLAFAREDFLRKWENPAQNTASLEDFDRLKTLGTGSFGRVML
VRHRESGQHYAMKILNKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYSFKDNTNLYMV
MQYVQGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLMYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFST
TDWIAIYQRRVEAPFVPKCRGPGDTSNFDDYEEEEIRVSFTEKCAKEFAEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacacgccggccgccaaacggggcaacgagatggagagcgtcaaagagtttttg
gccttcgccagagaagatttcctcaggaaatgggagaatcctgcacagaacacagcgagt
ctggaggacttcgaccggctgaagactctgggcacgggctcattcggtcgcgtgatgctg
gtcagacaccgagagagcgggcagcactacgccatgaagatccttaacaaacagaaggtt
gtgaagctgaagcagattgagcacactctcaacgagaagcggatactgcaggccgtcagc
ttccccttcttagtgcggctggagtactccttcaaggacaacactaatctctacatggtg
atgcagtacgtccagggaggagagatgttttcacacctgcgtagaatcggcagattcagt
gaaccccatgcgcggttttatgcttcacaaatagtcttgacatttgaatatctgcatgcc
ctcgacctgatctacagagaccttaaaccagagaacctcctcatcgatcagcagggctat
atacaggtgacagactttggcttcgcgaagcgggtcaagggtcgcacatggacattgtgc
ggcaccccggagtatctggccccagagatcatcctcagcaagggttataataaggctgtg
gactggtgggctctgggtgtgctgatgtacgagatggctgccggttatcctccgtttttt
gccgatcaacccattcagatctacgaaaagattgtctcaggaaaggtacggttcccgtca
cacttcagctccgacctgaaggacctgttgagaaacctgctgcaggtggatctcaccaaa
cgctacggcaaccttaaaaacggagttaacgacatcaaaggacacaagtggttctcaact
actgactggatagccatttaccagcggagggtggaggccccgtttgtgcctaaatgcaga
ggtcccggggacaccagcaacttcgacgactatgaggaagaagagatccgtgtgtcgttc
acggagaagtgtgcgaaagaatttgccgagttctag

KEGG   Sinocyclocheilus anshuiensis: 107703755
Entry
107703755         CDS       T04917                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04340  Hedgehog signaling pathway
sanh04371  Apelin signaling pathway
sanh04530  Tight junction
sanh04540  Gap junction
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107703755
   04310 Wnt signaling pathway
    107703755
   04340 Hedgehog signaling pathway
    107703755
   04371 Apelin signaling pathway
    107703755
   04020 Calcium signaling pathway
    107703755
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107703755
  09143 Cell growth and death
   04114 Oocyte meiosis
    107703755
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107703755
   04540 Gap junction
    107703755
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107703755
   04912 GnRH signaling pathway
    107703755
   04914 Progesterone-mediated oocyte maturation
    107703755
   04916 Melanogenesis
    107703755
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107703755
   04270 Vascular smooth muscle contraction
    107703755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107703755
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107703755
   03036 Chromosome and associated proteins [BR:sanh03036]
    107703755
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107703755
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107703755
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107703755
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107703755
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107703755
NCBI-ProteinID: XP_016361963
UniProt: A0A671P1M8
LinkDB
Position
Unknown
AA seq 351 aa
MGNTPAAKRDNEMESVKEFLAFAREDFLRKWENPAQNTASLEDFDRLKTLGTGSFGRVML
VRHRESGQHYAMKILNKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYSFKDNTNLYMV
MQYVQGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLMYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFST
TDWIAIYQRRVEAPFVPKCRGPGDTSNFDDYEEEEIRVSFTEKCAKEFAEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacacgccggccgccaaacgggacaacgagatggaaagcgtcaaagagtttctg
gccttcgccagagaagatttcctcaggaaatgggagaatcctgcacagaacacagcgagt
ctggaggacttcgaccggctgaagactctgggcacgggctcattcgggcgcgtgatgctg
gtcagacaccgagagagcgggcagcactacgccatgaagatccttaacaaacagaaggtc
gtgaagctgaagcagattgagcacacgctcaacgagaagcggatactgcaggccgtcagc
ttccccttcttagtgcggctggagtactccttcaaggacaacactaatctctacatggtg
atgcagtacgttcagggaggagagatgttttcacacctgcgtagaatcggcagattcagt
gaaccccatgcgcggttttatgcttcacaaatagtcttgacatttgaatatctgcatgcc
ctcgacctgatctacagagaccttaaaccagagaacctcctcatcgatcagcagggctat
atacaggtgacagactttggtttcgcgaagcgggtcaagggtcgcacgtggacattgtgc
ggcaccccggagtatctggccccagagatcatcctcagcaagggttataataaggctgtg
gactggtgggctctgggtgtgctgatgtacgagatggctgccggttatcctccgtttttt
gccgatcaacccattcagatctacgaaaagattgtctcaggaaaggtacggttcccgtca
cacttcagctccgacctgaaggacctgttgagaaacctgctgcaggtggacctcaccaaa
cgctacggcaaccttaaaaacggagttaacgacatcaaaggtcacaagtggttctcaact
actgactggatagccatttaccagcggagggtggaggccccgtttgtgcctaaatgcaga
ggtcccggggacaccagcaacttcgacgactacgaggaagaagagatccgtgtgtcgttc
acggagaagtgcgcgaaagaatttgccgagttctag

DBGET integrated database retrieval system