KEGG   Sinocyclocheilus anshuiensis: 107658725
Entry
107658725         CDS       T04917                                 

Definition
(RefSeq) uncharacterized protein LOC107658725
  KO
K05461  KIT ligand
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107658725
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107658725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sanh04052]
    107658725
Cytokines and growth factors [BR:sanh04052]
 Growth factors
  Growth factors (RTK binding)
   107658725
SSDB
Other DBs
NCBI-GeneID: 107658725
NCBI-ProteinID: XP_016302865
LinkDB
Position
Unknown
AA seq 243 aa
MLSIGTRGERHAKTTDPETVLSRSDTYKHFSFLISKGGACWLYVNLYHVESSLKTLALKF
GNLSTNKVNITIFITMLESFRFTLDSEELEVTMQTFECHYRRGKWPTRRYFNHVKEVLTA
AGSTVGKFHDCTPPPCKTPPAPPFTPGESRQQNGMSGAIHGLLALLIIPSMALLVLTVTM
VFRRSDCCAQRMHEVSLNEPHDGAEESRAGPHSGAAQGHPDSSSSSQQDRAWVDSLGCAD
TEV
NT seq 732 nt   +upstreamnt  +downstreamnt
atgctctccatcgggaccagaggagaaagacacgccaaaaccactgatcccgagaccgtc
ctttccagaagtgacacctataagcatttttcttttctaatatctaagggtggagcttgc
tggctgtatgtgaacctgtatcacgttgaaagcagtttaaaaacattggccctcaagttt
ggcaacctgtccaccaataaagtgaacatcactatttttataacaatgctggagagtttt
cgtttcactctggacagtgaggagctggaggtgacaatgcaaacattcgagtgccactac
agaaggggaaagtggccgactagacgttactttaaccatgttaaagaggttcttacagcg
gctggatccacggttggcaaatttcatgactgcacacctcctccttgcaagaccccgcca
gctcctcctttcacaccaggtgaaagcagacagcagaacggtatgagcggagcaattcat
gggctcttggcgctgctcatcatccctagcatggcgcttctggtcctcactgtcacgatg
gtattcagaagaagcgactgttgtgcgcaaagaatgcatgaagtcagcttgaatgagccc
cacgacggagctgaagaaagcagagccgggccccacagcggagctgcgcaagggcaccct
gattccagctctagcagccaacaggacagggcatgggtggattctttagggtgtgcagac
acagaggtttaa

DBGET integrated database retrieval system