KEGG   Sinocyclocheilus anshuiensis: 107659302
Entry
107659302         CDS       T04917                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh04371  Apelin signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107659302
   04350 TGF-beta signaling pathway
    107659302
   04371 Apelin signaling pathway
    107659302
   04068 FoxO signaling pathway
    107659302
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107659302
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107659302
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 107659302
NCBI-ProteinID: XP_016303719
LinkDB
Position
Unknown
AA seq 505 aa
MSVSSTPTSNDACLSIVHSLMCHRQGGESESFSKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYTRLWRWPDLHKNELKHVKYCQFAFDLKC
DSVCVNPYHYERVVSPSIDLSVLTLGGPGPSVDPLVKDEFDGQPSHSAADGGHSIQTIQH
TASSSAPPDAFNSPALLPPADSASSASTSAFTSMAAGPTNAPSSWPRGSSFPPSIPHQNG
HLQHHPPLPHTGQYWSVHNELAFQPPISTHTAPDYWCSIAYFEMDIQVGETFKVPSNCPV
VTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVHCLSDHAV
FVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAG
NIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEI
HLHRALQLLDEVLHTMPVADPQPLD
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtccgtctccagcacacccaccagtaatgatgcctgtctgagcatcgtccacagtctc
atgtgccatcgacagggaggagagagcgagtctttctccaaacgagcgatagagagcttg
gtgaagaagctgaaagagaagaaggatgagttagactctctgatcactgccatcactacg
aatggagctcatcccagtaaatgtgtgactatacaacgcacgctagatggtagactgcag
gtggccggtcgtaaaggatttcctcatgttatatacacacggctgtggcgatggccggac
ctgcacaagaacgagctgaaacatgtgaaatactgccagtttgcctttgacctgaaatgc
gacagcgtgtgtgtgaacccgtaccactacgagagggttgtgtctccaagcatcgatctg
tctgttctgactctgggtggcccaggtccgagtgtagatcccctggtgaaggatgagttc
gatggtcagccgtctcattctgctgctgatggaggtcacagtattcaaaccatccagcac
acagcctcttcctctgccccgcccgacgctttcaatagccccgccctcctgccgccagcc
gactccgcaagctccgcctccacttctgcattcaccagtatggctgcaggtccaaccaat
gcccccagctcatggcccagaggaagcagttttcctcccagcatccctcatcagaacggc
cacctgcagcaccaccctcctcttcctcatacgggccagtactggtcagtgcataatgag
ctggcgttccagcctcccatatccacccatacagctccagattactggtgctcgattgcg
tactttgagatggacattcaggtgggcgagacgtttaaggtgccgtctaactgtcccgtc
gtgacggtggacggttatgtggacccgtcaggtggagatcgcttctgtctcggccagctg
agtaacgtacatcgcacagaggccatcgagagagccaggcttcacatcggtaaaggtgtt
cagctggagtgtaaaggagagggtgacgtgtgggtgcactgcctcagtgaccacgctgtg
tttgtgcagagctattatctggaccgcgaggctggacgagctccgggtgacgccgtccac
aagatttaccccagtgcctacatcaaggtgtttgatctgcgtcagtgtcatcggcagatg
cagcagcaggcggcgacggctcaggctgcagcagctgcgcaggcggctgcggtggcggga
aacatcccgggcccgggttcggtgggaggcatcgcccctgctatcagtctgtctgctgcg
gcgggcatcggcgtggacgacctgcggcgtctctgtattctgcgcatgagtttcgtcaag
ggctggggtcccgattaccctcgccagagcatcaaggagaccccgtgttggatcgaaatt
catctgcaccgcgccctgcagctcttggacgaggttctgcacaccatgcctgtagccgac
ccgcaacctctggactga

KEGG   Sinocyclocheilus anshuiensis: 107665456
Entry
107665456         CDS       T04917                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh04371  Apelin signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107665456
   04350 TGF-beta signaling pathway
    107665456
   04371 Apelin signaling pathway
    107665456
   04068 FoxO signaling pathway
    107665456
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107665456
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107665456
SSDB
Motif
Pfam: MH2 IRF-3
Other DBs
NCBI-GeneID: 107665456
NCBI-ProteinID: XP_016311817
LinkDB
Position
Unknown
AA seq 394 aa
MVKDEYDFEGQQSLPSTEGHMQTIQHPPSRPVAPEPFNTPAMLPPVEGSSSASISAFSSI
AVGSTTQPNSVLSGSHSSDGLLQIASGTGQGSQQNGFPPGQPSTYHHNTSSSWTRNSNFT
PTVPHHQNGHLQHHPPMTHPAHYWPVHNEITFQPPISNHPAPEYWCSIAYFEMDVQVGET
FKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVW
VRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAA
AAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSI
KETPCWIEIHLHRALQLLDEVLHTMPIADPTPLD
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggtgaaggatgagtatgattttgaaggccagcagtctctgcccagcactgagggacac
atgcagacgattcaacaccctccctctcgaccggtggccccggagcccttcaacacgccc
gccatgctcccgccagtagagggcagcagctcggcctccatctccgcattctccagcatc
gcagtgggatccacaactcagcccaatagcgttctctcaggaagccacagcagtgatggt
ctgctgcagattgcctctgggacggggcagggctcacagcagaatggcttcccccccggc
cagccctccacgtaccatcacaacaccagctccagctggacgaggaacagtaacttcacc
cccactgtgcctcaccatcagaacggccatctacagcatcacccgcccatgacccatcca
gcgcactactggcccgttcacaacgaaatcacattccagccaccgatatccaaccaccct
gctccagagtactggtgctccatcgcttacttcgagatggacgttcaagtgggcgagacc
tttaaggttccctcgtcctgtccgatcgtgaccgtcgacgggtatgtggacccctccgga
ggagatcgcttctgcctcggccagctcagcaacgtccaccgaacggaggccatcgagaga
gcaagactgcacatcgggaagggtgtccagctggagtgtaaaggcgaaggcgatgtttgg
gttcgctgtctaagcgatcacgccgtcttcgtccagagctactacttggatcgtgaagcc
ggccgcgctcctggagatgccgtgcacaagatctaccccagcgcatacatcaaggtgttt
gatctgcgtcagtgccacagacagatgcagcagcaggcggcgacagcacaagcagcggcg
gccgctcaagcagcagcggtggccggaaacatccccggccccggatccgtgggaggaatc
gctcctgctatcagtttgtctgcggccgctggcatcggtgtggacgacctccgccggctc
tgcatcctgcgcatgagcttcgtcaagggctggggtcccgattacccccgacagagcatc
aaagagacgccctgctggatcgagatccacctgcaccgcgcactgcagctgctggacgag
gtcctgcacaccatgcccatcgccgaccccacgccgctggactga

KEGG   Sinocyclocheilus anshuiensis: 107668639
Entry
107668639         CDS       T04917                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh04371  Apelin signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107668639
   04350 TGF-beta signaling pathway
    107668639
   04371 Apelin signaling pathway
    107668639
   04068 FoxO signaling pathway
    107668639
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107668639
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107668639
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 107668639
NCBI-ProteinID: XP_016316071
UniProt: A0A671N7L3
LinkDB
Position
Unknown
AA seq 547 aa
MSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKQVKYCQFAFDLKC
DSVCVNPYHYERVVSPGIDLSGLTLSGSGPSGLMVKDEYDYEGQQSLPSTEGHMQTIQHP
PSRPMAPEPFNTPVMLPPAEGSGSASTSAFSSIAVGSATQPNSVLSGSHSSDGLLQIASG
TGQGSQQNGFPPGQPSTYHHNTSSSWTRNSNFTPTVPHHQNGHLQHHPPMTHPAHYWPVH
NEIAFQPPISNHPSPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLG
QLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDA
VHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLS
AAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPI
ADPTPLD
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgtccatcacaaacacacccaccagtaacgatgcctgtctgagcatcgtgcacagtctg
atgtgtcacagacagggcggcgagagcgagaccttcgccaaacgggccattgagagtctg
gtgaagaaactgaaggagaagaaagacgagctggattcgctcatcaccgccatcaccacc
aacggcgctcatcccagcaaatgtgtgaccatacagagaacgctagacggcaggctgcag
gtggctggtcgtaaaggattcccacatgtcatctatgcacggttatggcgatggccggac
cttcataagaacgagttgaaacaagtcaagtactgccagtttgcctttgacctgaagtgt
gacagcgtgtgtgtgaacccttaccattacgagagagtcgtgtctccaggaatagactta
tccggactcacactgtcaggctctggtccgtcgggtctgatggtgaaggatgagtatgat
tatgaaggccagcagtctcttcccagcactgagggacacatgcagacgattcaacaccct
ccctctcgaccgatggccccggagcccttcaacacgcctgtcatgctcccgccagcagag
ggcagcggctcggcctccacctccgccttctccagcatcgcggtgggatccgcaactcag
cccaatagcgttctctcaggaagccacagcagcgatggtctgctgcagattgcctctggg
acggggcagggctcacagcagaatggcttcccccccggccagccctccacgtaccatcac
aacaccagctccagctggacgaggaacagtaacttcacccccactgtgcctcaccatcag
aacggccatctacagcatcacccgcccatgacccatccagcgcactactggcccgttcac
aatgaaatcgcctttcagcctccgatttccaaccacccttctccagagtactggtgctcc
atcgcttacttcgagatggacgttcaagtgggcgagacgtttaaagttccctcgtcctgt
ccgatcgtgaccgtcgacgggtacgtggacccctccggaggagatcgcttctgcctcggc
cagctcagcaacgtccaccgaacggaggccatcgagagagcaagactgcacatcgggaag
ggcgtccagctggagtgtaaaggcgaaggcgatgtttgggttcgctgtctgagcgatcac
gccgtcttcgtccagagctactacttggatcgtgaagccggccgcgctcctggagatgcc
gtgcacaagatctaccccagcgcatacattaaggtgtttgatctgcgtcagtgccacaga
cagatgcagcagcaggcggcgacagcacaagcagcggcggccgctcaagcagcagcggtg
gccggaaacatccccggccccggatccgtgggaggaatcgctcctgctatcagtttgtct
gcggccgctggaatcggtgtggacgacctccgccggctctgtatcctgcgcatgagcttc
gtcaagggctggggtcccgattaccctcgacagagcatcaaagagacgccctgctggatc
gagatccacctgcaccgcgcgctgcagctgctggacgaggtcctgcacaccatgcccatc
gccgaccccacgccgctggactga

KEGG   Sinocyclocheilus anshuiensis: 107672874
Entry
107672874         CDS       T04917                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh04371  Apelin signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107672874
   04350 TGF-beta signaling pathway
    107672874
   04371 Apelin signaling pathway
    107672874
   04068 FoxO signaling pathway
    107672874
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107672874
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107672874
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 107672874
NCBI-ProteinID: XP_016321739
LinkDB
Position
Unknown
AA seq 571 aa
MSVNSPNSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQYAFDLKYD
NVCVNPYHYERVVSPGIVGLSLQNTGPTGRLIKEEYSHDCIQMDVPPGLPPQQDHQGAMK
LPPPDHYGQPLPPLQLPSEPSRAPPPVTLYSNMPLSPTASGSMMPMQGGHGEGLLQIASP
QGQVMTPTPPPSTPTHGPPQTPVPPQPPPNQNGYNSSKHSQTQGSFHTTWTGSSTASYTP
LGPQQNGRGHQPPLHHPHFWSQHHSSASFPPPVSNHPGPEFWCSISYFEMDVQVGEMFKV
LSSCPVVTIDGYVDPSGGDRFCLGQLSNVHRTDASERARLHIGKGVQLECRGEGDVWMRC
MSDHAVFVQSYYLDREAGRAPGDAVHKIYPGAYIKVFDLRQCHRQMQQQAATAQAAAAAQ
AAAVAGNIPGPGSVGGIAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKHT
PCWVEVHLHRALQLLDEVLHTMPLADPGPAN
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgtccgtgaactctcccaacagtaatgatgcctgcctcagtatcgtgcacagcctcatg
tgccacaggcagggcggcgaaaacgagggcttcgccaagcgtgccatcgagagcctggtc
aagaaactgaaggagaagaaggacgagctggactccctcatcaccgccatcaccaccaac
ggagtccatcccagcaagtgtgtgaccatccagaggacgctggacggacgcctacaggtt
gccgggcgtaaaggttttcctcatgtaatctacgcgcggttgtggcgctggcctgacctt
cacaagaacgagctgaagcatgtgaaattctgtcagtatgcatttgacctcaaatacgat
aatgtctgtgtcaacccttaccattatgagagagtggtgtcaccaggcatcgttggtctc
agtcttcaaaacacgggtcccactggcagactaataaaggaagagtacagccacgactgc
attcagatggacgttccccctggcctgcctcctcagcaggaccaccagggggcgatgaaa
ctccctcctccggaccactacggccagccactgcctcctctacagctgccttcagaaccc
agccgcgcccccccaccggtcaccctttactccaacatgcccctctcccccaccgcttca
ggctctatgatgccgatgcagggaggtcacggtgaaggcttacttcagattgcgtctcct
cagggtcaagtcatgacccctacacctcccccctccacccccacacatggacccccacag
acccccgtcccaccgcagcctccacccaaccagaacggctacaacagctccaaacactcc
cagacgcaaggctcctttcacacaacctggacaggcagcagcacagcctcctacactcct
ttaggaccccagcaaaacggtcgcggccaccagcctcctctccaccacccacacttctgg
tctcagcatcacagttcagcgtctttcccccctccagtctccaaccatccaggtcctgag
ttctggtgctccatctcatacttcgagatggatgtgcaggtgggggagatgtttaaagtg
ctgtccagctgtccggtggtgacgattgacgggtatgtggacccctcaggaggagaccgc
ttctgcctgggtcagctcagtaatgtgcaccgcacagacgccagtgagcgcgccaggttg
cacataggtaaaggagtgcagctggagtgccgcggcgagggcgacgtatggatgcgctgc
atgagcgatcatgctgtctttgtgcagagttactacctggacagagaagcgggtcgagcg
ccaggagatgcagtgcacaagatctacccaggggcctacataaaggtctttgacctcagg
cagtgccacaggcagatgcagcagcaggcggccacggcgcaggcggcggcggcagcacag
gccgcggcggtggcagggaatattccaggaccaggaagcgtcggtggaatcgctcctgca
gtcagcctctcggcagcagcagggattggtgtggatgatctccggaggctgtgcatcctg
cgcctgagcttcgtgaagggctggggtcctgactatccgcggcagagcatcaagcacacc
ccctgctgggtggaggtgcatttgcaccgggcgctgcagctgctagacgaggtgctgcac
actatgccactggcagaccctggaccggctaactga

KEGG   Sinocyclocheilus anshuiensis: 107681580
Entry
107681580         CDS       T04917                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh04371  Apelin signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107681580
   04350 TGF-beta signaling pathway
    107681580
   04371 Apelin signaling pathway
    107681580
   04068 FoxO signaling pathway
    107681580
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107681580
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107681580
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 107681580
NCBI-ProteinID: XP_016333379
UniProt: A0A671M3V5
LinkDB
Position
Unknown
AA seq 568 aa
MSVNAPSSSDACLSIVHSLMCHRQGGENESFAKRAIESLVKKLKEKRDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYTRLWRWPDLHKNELKHVKFCQYAFDLKYD
NVCVNPYHYERVVSPGIVGFSLPNTGRLIKEEHIHNCIQMAGPSSMTLQQDHHPPDHYSP
QPLRLMSPEPSQRTTSSVTLYPSLPLSPASSASRLSMQAEHPEALLQIASPAGRALTSSS
PPSTLTHSHAPTHSQPSSQQPSVSQSEYSTSKHTQTQGSYHTTTWTGNSTASYTPAGPQQ
NGRSHQQAPPPRTSHFWSQHHTPASYPQPVSNHPGPEFWCSISYFEMDVQVGEMFKVLAN
CPVVTVDGYVDPSGGDRFCLGQLSNVHRTDASERARLHIGKGVQLECRGEGDVWMRCLSD
HAVFVQSYYLDREAGRAPGDAVHKIYPGALIKVFDLRQCHRQMQQQAATAQAAVAAQAAA
VAGNILGPGSVGGIAPAISLSAAAGIGVDDLRCLCILRLSFVKGWGPDYPRQTIKQTPCW
VEVHLHRALQLLDEVLHTLPLADPGPAN
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgtctgtgaatgcgcccagcagcagtgatgcatgtttaagcatcgttcacagcctgatg
tgccaccgccagggaggagagaatgagagctttgccaaacgtgccatagaaagcctggta
aagaaactcaaagagaaaagagatgagctcgactccctcatcactgctatcaccacaaat
ggagtccatccaagcaagtgtgtcaccatacaaagaacgctggacggacgtttgcaggtg
gctgggcggaagggtttccctcatgtcatatacactcgtctgtggcgatggccggacctt
cacaagaatgaactcaagcatgtcaagttctgtcagtatgctttcgatctgaagtacgat
aacgtgtgtgtcaacccctaccactatgagcgtgtggtgtcccctgggattgtgggattc
agtttgccaaacacaggcaggctgataaaagaagagcacatacataactgcatccagatg
gcgggtccgtcaagtatgaccttacagcaagaccatcatcctccagatcactacagccca
cagcctctgagactgatgtccccagagccgtcccagcggaccacttcctcggtcacactc
taccccagtctgcccctctctccagcctcaagtgcatccaggttgtcaatgcaggcggaa
caccctgaggcactgttgcagatcgcctcaccagcaggacgggccttgacctccagctct
ccaccttccaccctaacacatagtcatgcacccacacacagccagccttcgtcccagcag
ccctccgtcagccagagtgaatacagcacctccaagcacacacagacacagggatcttac
cacacaacaacctggacggggaacagcacagcctcctatactcctgctggaccacagcag
aatgggcggagtcatcagcaagcccctccccctcgtactagccacttctggtctcagcat
cacacaccagcctcataccctcaaccagtctccaaccatccaggcccagagttctggtgc
tcaatctcttacttcgagatggacgtgcaggtcggggagatgtttaaggttctagccaat
tgtcctgtggtgacagtggatggatatgtggacccttcgggtggggaccgcttttgtttg
ggtcagcttagcaatgttcacagaactgatgccagcgagagggcacggcttcacattggt
aaaggtgttcagctggagtgccgtggggagggggacgtgtggatgcgttgcctcagtgac
catgctgtattcgtgcaaagttactacttggacagagaggcagggagagcgccaggggat
gccgttcacaagatctacccaggagccctcattaaggtgtttgatcttcgtcagtgtcac
aggcagatgcagcagcaagcggcgactgcacaggcagctgtggctgcgcaggctgcagca
gtggctgggaacatcctggggcctggcagtgttggaggcatcgctccagccatcagtctg
tctgcggcagctgggataggtgttgatgacctgcggtgtttgtgtatcctgcggcttagt
tttgtaaagggctggggaccggactaccctcgacagaccatcaaacagacaccgtgctgg
gtggaagttcatctacaccgtgccctgcagctgctagacgaggtcctgcacaccctgccc
ctcgctgaccccggacctgccaactga

KEGG   Sinocyclocheilus anshuiensis: 107689912
Entry
107689912         CDS       T04917                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh04371  Apelin signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107689912
   04350 TGF-beta signaling pathway
    107689912
   04371 Apelin signaling pathway
    107689912
   04068 FoxO signaling pathway
    107689912
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107689912
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107689912
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 107689912
NCBI-ProteinID: XP_016343577
UniProt: A0A671LGA4
LinkDB
Position
Unknown
AA seq 501 aa
MSQHNNVVITPQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQYAFDLKYDNVCVNPY
HYERVVSPGIVGFSLPNTGRLIKEEHIHDCIQMEGPSSMALQLDHPPPDHYSPQPLRLMS
PELPQRTTSSVTLYPSLPLSPPSSASRLSMQVERPEGLLQIASPAGRALTSSSPPSTPTH
SHAPTHSQPSSQQPSVSQSEYSTSKHTQTQGTYHTTTWTGTSTASYTPAGPQQNGRSHQQ
APPPHTSHFWSQHHTPASYPQPVSNHPGPEFWCSISYFEMDVQVGEMFKVLANCPVVTVD
GYVDPSGGDRFCLGQLSNVHRTDASERARLHIGKGVQLECRGEGDVWMRCLSDHAVFVQS
YYLDREAGRAPGDAVHKIYPGALIKVFDLRQCHRQMQQQAVTAQAAAAAQAAAVAGNIPG
PGSVGGIAPAISLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQTIKQTPCWVEVHLHR
ALQLLDEVLHTMPLADPGPAN
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgtcacaacataataatgttgtgattactcctcaggtggctgggcggaaaggtttccct
catgtcatatacgctcgtctgtggcgatggccggaccttcacaagaatgaactcaagcat
gtcaagttctgtcagtatgcattcgatctgaagtacgataacgtgtgtgtgaacccctac
cattatgagcgcgtggtgtcccctgggattgttggattcagtttgccaaacacaggcagg
ctgataaaagaagagcacatacatgactgcatacagatggagggtccgtcgagtatggcc
ttacagctagaccatcctcctccagatcactacagcccacagccgctgagactgatgtcc
ccagagctgccccagcgaaccacttcctctgtcactctctaccccagcctgcccctctct
ccaccctcaagtgcatccaggttgtcaatgcaggtggaacgtcctgagggactgttgcag
atcgcatccccagcgggacgggccttgacctccagctctccaccttccaccccaacacac
agtcacgcacccacacacagccagccttcttcccagcagccctccgtcagccagagtgaa
tacagcacctcaaagcacacacagacacagggaacttaccacacaacaacctggacaggg
accagcacagcctcctatactcctgctggaccacagcagaatgggcggagtcatcagcaa
gcccctccccctcacactagccacttctggtctcagcatcacacaccagcctcataccct
caaccagtttctaaccatccaggcccagagttctggtgctcaatctcttacttcgagatg
gatgtgcaggtcggggagatgtttaaagttctagccaactgtcctgtggtgacagtggat
ggatatgtggacccttcaggcggggaccgcttttgtttgggtcagcttagcaatgttcat
cgaactgatgccagcgagagggcacggcttcacattggtaaaggtgttcaactggagtgc
cgtggggagggggacgtgtggatgcgttgccttagtgaccatgctgtattcgtgcaaagt
tactacctggacagagaggcagggagagcgccaggggatgccgttcacaagatctaccca
ggagccctcattaaggtgtttgatcttcgtcagtgtcacaggcagatgcagcagcaagcg
gtgactgcgcaggcagctgcggctgcacaggctgcagcagtggctgggaacatcccgggg
cctggcagtgttggaggaatcgctccagccatcagtctgtcggcggcagccggaataggt
gttgatgacctgagacgtttgtgtatccttaggctgagttttgtaaaaggctggggaccc
gactaccctcgacagaccatcaaacagacaccgtgctgggtggaagttcatctacaccgt
gccctgcaactgttggacgaggtcctgcacaccatgcccctcgctgaccccggacctgcc
aactga

KEGG   Sinocyclocheilus anshuiensis: 107698642
Entry
107698642         CDS       T04917                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh04371  Apelin signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107698642
   04350 TGF-beta signaling pathway
    107698642
   04371 Apelin signaling pathway
    107698642
   04068 FoxO signaling pathway
    107698642
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107698642
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107698642
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 107698642
NCBI-ProteinID: XP_016355190
UniProt: A0A671SK85
LinkDB
Position
Unknown
AA seq 571 aa
MSVNPPNSNDACLSIVHSLMCHRQGGENEGFAKRAIESLVKKLKEKKDELDSLITAITTN
GVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQYAFDLKYD
NVCVNPYHYERVVSPGIVGLSLQNTGPTGRLIKEEYSHDCIQMDVPPGLPPQQDHQGAMK
LPPPDHYGQPLPPLQLPSEPSRAPPPVTLYSNMPLSPTASGSMMPMQGGHGEGLLQIASP
QGQVMTPTPPPSTPTHGPPQTPVPPQPPPNQNGYNSSKHSQTQGSFHTNWTGSSTASYTP
VGPQQNGRGHQPPLHHPHFWSQHHSSASFPPPVSNHPGPEFWCSISYFEMDVQVGEMFKV
LSSCPVVTIDGYVDPSGGDRFCLGQLSNVHRTDASERARLHIGKGVQLECRGEGDVWMRC
MSDHAVFVQSYYLDREAGRAPGDAVHKIYPGAYIKVFDLRQCHRQMQQQAATATAAAAAQ
AAAVAGNIPGPGSVGGIAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKHT
PCWVEVHLHRALQLLDEVLHTMPLADLGPAN
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgtccgtgaaccctcccaacagtaatgacgcctgcctgagtatcgtgcacagtctgatg
tgccacaggcagggcggagaaaacgagggcttcgccaagcgtgccatcgagagcctggtc
aagaaactgaaggagaagaaggatgagctggactccctcatcaccgccatcaccaccaat
ggagtccatcccagcaagtgtgtgaccatccagaggacgctggacggacgcctacaggtt
gctgggcgtaaaggttttcctcatgtaatctatgcgcggttgtggcgctggcccgacctt
cacaagaatgagctgaagcatgtgaaattctgccagtacgcatttgacctcaaatacgat
aatgtctgtgtgaacccttaccattacgagagagtggtgtcaccaggcatcgttggtctt
agtcttcaaaacacgggtcccactggcagactaataaaggaagagtacagccacgactgc
attcagatggacgttccccctggcctgcctcctcagcaggaccaccagggggcgatgaaa
ctccctcctccggaccactacggccagccactgcctcctctacagctgccttcagaaccc
agccgcgcccccccaccggtcaccctttactccaacatgcccctctcccccaccgcttca
ggctctatgatgccgatgcagggaggtcacggtgaaggcttacttcagattgcgtctcct
cagggtcaagtcatgacccctacacctcccccctccacccccacacatggacccccacag
acccctgtcccaccccagcctccacccaaccagaacggctacaacagctccaaacactcc
cagacgcaaggctcctttcacacaaactggacaggcagcagcacagcctcctacactcca
gtaggaccccagcaaaacggacgcggccaccagcctcctctccatcacccacacttctgg
tctcagcatcacagttcagcgtctttcccccctccagtctccaaccatccaggtcctgag
ttctggtgctccatctcatactttgagatggatgtgcaggtgggggagatgtttaaagtg
ctgtccagctgtccggtggtgacgattgacgggtatgtggacccctcaggaggagaccgc
ttctgcctgggtcagctcagtaatgtgcaccgcacagacgccagtgagcgcgccaggttg
cacataggtaaaggagtgcagctggagtgtcgcggcgagggcgatgtgtggatgcgctgc
atgagcgatcatgccgtctttgtgcagagttattacctggacagagaagcgggtcgagcg
ccaggagatgcagtgcacaaaatctacccaggggcctacataaaggtctttgacctcagg
cagtgccacaggcagatgcagcagcaggcggcaacggctacggcggcggcggcagcacag
gccgcagcggtggcagggaatattccaggaccaggaagcgttgggggaatcgctcctgca
gtcagcctgtcagcggcagcagggattggggtggatgatctccggaggctgtgcatcctg
cgcctgagcttcgtgaagggctggggtcctgactatccacggcagagcatcaagcacacc
ccctgctgggtggaggtgcatttgcaccgggcgctgcagctgctggacgaggtgctgcac
actatgccactggcagaccttggaccagctaactga

KEGG   Sinocyclocheilus anshuiensis: 107704085
Entry
107704085         CDS       T04917                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04310  Wnt signaling pathway
sanh04350  TGF-beta signaling pathway
sanh04371  Apelin signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107704085
   04350 TGF-beta signaling pathway
    107704085
   04371 Apelin signaling pathway
    107704085
   04068 FoxO signaling pathway
    107704085
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107704085
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107704085
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 107704085
NCBI-ProteinID: XP_016362418
LinkDB
Position
Unknown
AA seq 505 aa
MSVSSTPTSNDACLSIVHSLMCHRQGGESESFSKRVIESLVKKLKEKKEELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQFAFDLKY
DSVCVNPYHYERVVSPSIDLSVLTLGGPGLSVDPLVKDEFDAQPSHSAADGGQSIQTIQH
TSSSSAPPNAFNSPAFLPPADSASSASTSTFTSMAAGPTNAPSSWPRGSSFPPSIPHQNG
HLQHHPPLPHTGQYWSVHNELAFQPPISTHPAPDCWCSIAYFEMDIQVGETFKVPSNCPV
VTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVHCLSDHAV
FVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAVAAQAAAVAG
NIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRKSIKETPCWIEI
HLHRALQLLDEVLHTMPIADPQPLD
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtccgtctccagcacacccaccagtaatgatgcctgtctgagcatcgtccacagtctc
atgtgccatcgacagggaggagagagcgagtctttctccaaacgagtgatcgagagcttg
gtgaagaagctgaaggagaagaaggaggagttagactctctgatcactgccatcactacg
aacggagctcatcccagtaaatgtgtgactatacaacgcacgctagacggtagactgcag
gtggccggtcgtaaaggatttcctcatgtcatatacgcacggctgtggcgatggccagac
ctgcacaagaacgagctgaaacacgtgaaatactgccagttcgcctttgacctgaaatat
gacagcgtgtgtgtgaacccgtaccactacgagagggtcgtgtctccaagcatcgatctg
tctgttctgactctgggtggcccaggtctgagtgtagatcccctggtgaaggatgagttc
gatgctcagccgtctcattctgctgctgatggaggtcaaagtattcaaaccatccagcac
acttcctcttcctctgccccgcccaatgctttcaacagccctgccttcctgccaccagct
gactccgcaagctccgcctccacttccacattcaccagtatggctgccgggccaaccaat
gcccccagctcatggcccagaggaagcagttttcctcccagcatccctcatcagaacggc
cacctgcagcaccaccctcctcttcctcacacgggccagtactggtcagtccataatgag
ctggcattccagccgcccatatccacccatccagctccagattgctggtgctcgattgcg
tactttgagatggacattcaggtgggtgagacatttaaggtgccgtctaactgtcccgtc
gtaacggtggatggttatgttgacccgtcaggtggagatcgcttctgcctcggccagctg
agtaacgtacatcgcacagaggccatcgagagagccaggcttcacatcggtaaaggtgtt
cagctggagtgtaaaggcgagggtgatgtgtgggtgcactgtctcagtgaccatgctgtg
tttgtccagagctattatctggaccgcgaggctggacgagctccaggtgacgccgttcac
aagatttaccccagtgcctacatcaaggtgtttgatctgcgtcagtgtcatcggcagatg
cagcagcaggcggcgacggctcaggctgcggtggctgcgcaggcggctgcggtggcggga
aacatcccaggcccgggttcggtgggaggcatcgcccctgctatcagtctgtctgccgcg
gcaggcatcggcgtggacgacctgcggcgtctctgcattctgcgcatgagtttcgtcaag
ggctggggtcctgattaccctcgcaagagcatcaaggagaccccgtgctggatagaaatt
catttgcaccgcgctctgcagctcttggacgaggttctgcacaccatgcctatagccgac
ccgcaacctctggactga

DBGET integrated database retrieval system