KEGG   Sinocyclocheilus anshuiensis: 107659797
Entry
107659797         CDS       T04917                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1-like
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04621  NOD-like receptor signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Module
sanh_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107659797
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107659797
   04371 Apelin signaling pathway
    107659797
   04020 Calcium signaling pathway
    107659797
   04070 Phosphatidylinositol signaling system
    107659797
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107659797
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107659797
  09152 Endocrine system
   04912 GnRH signaling pathway
    107659797
   04916 Melanogenesis
    107659797
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107659797
   04270 Vascular smooth muscle contraction
    107659797
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107659797
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107659797
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107659797
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107659797
SSDB
Motif
Pfam: PH_14 PLC-beta_C PI-PLC-X PI-PLC-Y DUF1154 PHC2_SAM_assoc
Other DBs
NCBI-GeneID: 107659797
NCBI-ProteinID: XP_016304310
LinkDB
Position
Unknown
AA seq 1189 aa
MAGAQPGVHALQLKRVSVPESLRTGDKFIKWDDDCTTVTPVTLRVDPRGYFLYWTDQNKE
TDLLDLSLIKDTRNGRFAKTPKEAKQRELLDVGTLEGRLENRTLTVVSGADMVNITCLNF
TAFNEEVAKEWAEELFSLASNLLAQNMSRESCLEKVYTRLTLQLTAEGGIPVKNIFRLFS
ADRRRVENALEVCSLPTGRNDAIPQDTFTPDVYRQLLNNICPRNDIDTIFSEIGAKIRPY
LTVEQMTDFLNNRQRDPRLNEILYPPLKAEQVQGLVEKYEPDTMLSRRAGQLAGNSSVEM
YRQVLLSGCRCIELDCWKGRTADEEPFITHGFTMTSEICFKEVIEAIAESAFKMSPFPVI
LSFENHVDSPKQQAKMAEYCRSIFGDALLTDPLEKYPLEAGVPLPSPVDLMGKILIKNKK
NSHKADGSTKKKLFEQTSNPCSDTSSMCEPSSPSAGAHTKTPHSAVIRESVEPHWSTHQE
IHISIHADGNEAGERRLQGMKSIDKTTGSLSRNASLADDKAEADAESDAEEDNDESKKSM
DEGTVNEAFATEEMSNLVNYIQPVKFNSFEACKKIDRSYEMSSFVETKALELLKESPVEF
VEYNKLQLSRIYPKGTRVDSSNYMPQVFWNAGCQLVALNFQTIDLPMQLNLGIFEYNGKC
GYRLKPEFMRRTDKQFDPFTQNTVDGIVAHTLSVKIISGQFLSDKRVGVYVEVEMFGLPV
DTKRKAFKTKTSQGNAVNPVWDEDPVVFKRVVLPTLASLRIAVYEENGKFIGHRIIPVCA
IRPGYHYISLRNEKNQTLTLPSVFIYTEVKDYVPDTFADVIEALSNPILYISLMEQRANQ
LAALTQEEGAQETDREEVSGGGDPVSEVKTDPKPAAEYGLNHDSISPKSSVVSHQTSSSG
VCVSEVDAQSVDELKQMKGYLREQKKQYKELKELMRKHNKKTNELINEHASRQKQLRRSA
LQKRCVSDQDQDLLALEQERCEKLKEQQQRQLLTLRQEQFYSEKYLKREHVKLLVEKLTA
VAEECQNNQLKKLKDLCEKENKDLKKRMDKRRQEKFQEARTLEKTLTEEKKMKMNRSHVN
EVVQSIKRLEEAQDKRLERLLEKHKDIRQQILGDKPKLQSELDQEYQDKFRRLPAEIQEF
VQDSAACKGKLSQDSDFLPISRTPGKLKPSLSPAEDVERSSEKVFDTPL
NT seq 3570 nt   +upstreamnt  +downstreamnt
atggcgggagcgcagccgggggtccacgcgctccagctcaagcgcgtttcagtgcccgag
agcctgaggaccggcgacaagttcattaaatgggacgatgactgcactacagttacgccc
gtgacgctgcgtgttgacccgcggggctacttcctgtactggaccgatcagaataaggag
accgacctgttagacctctcgctcatcaaggatacgagaaatgggagatttgccaagacg
ccaaaggaggccaagcagcgagagcttctggatgtggggactctggaggggaggctggag
aaccggacactcacagtggtcagcggtgcagacatggtcaacatcacctgcctgaacttt
acagccttcaacgaagaggtggccaaggagtgggccgaagagcttttcagcttggcgtcg
aacctgctggctcagaacatgtccagagaatcctgtctggagaaagtgtacacaagactg
acgttacagctgacggccgagggtggcattcctgtgaaaaatatcttccgtctgttctcg
gccgacagacggagggttgaaaacgctctggaggtctgcagcctgccgacaggacgaaat
gacgccattcctcaggatacatttacacctgacgtataccgacagctcctgaacaacatt
tgtccgcggaacgacatcgatacgattttctcagaaatcggcgctaagatccggccgtac
ctcaccgtagagcagatgacggatttcctgaacaacagacagagagaccctcgtctgaac
gagatcctgtacccgcccctcaaagcggagcaagtgcagggattggtggagaaatacgag
cctgacaccatgctttcacgaagagcgggtcagctggcgggaaactcgtctgtggagatg
taccggcaggttttgctatccggctgtcgctgtatagagctggactgctggaaggggcgc
accgctgacgaggagccgttcatcactcacggcttcaccatgacctcagagatctgcttc
aaggaggtgattgaggccatcgcagagagcgccttcaagatgtctccgttcccagtcatc
ctgtcctttgagaaccatgtggactctcccaaacagcaggcgaagatggcagagtattgc
cgatcaatatttggagacgcattgctcacagacccactggagaaatatcccttggaggcc
ggtgttcctctgcccagccccgtggacctgatgggcaaaatcctcatcaagaacaagaag
aattcccacaaagctgacggcagcaccaagaagaagctcttcgagcaaacgtccaacccc
tgcagcgacacgtccagcatgtgtgagccctcgtctcccagcgcaggtgcacacacaaaa
acacctcattctgcagtcatcagagagtcagttgagccacactggtcgacacatcaggag
attcacatcagcattcatgcagacgggaacgaggcaggcgaaagaagattgcagggaatg
aagtcaattgataaaacgacagggtcgctatcacgcaacgcaagtctggccgatgataaa
gcagaagcggacgcagagagtgatgcagaggaagataacgatgaaagtaagaagtccatg
gatgaggggacggtaaatgaagccttcgccacagaggagatgtccaacttagtcaactac
attcagcctgttaaattcaactccttcgaggcgtgcaaaaaaatcgatcgaagttatgaa
atgtcatcgtttgtggagaccaaagcgctggagctgctcaaagaatcgccggtggagttc
gtcgagtataataaactgcagctgagcagaatttatcccaaaggaactcgagtggactcg
tcaaactacatgcctcaggtcttctggaacgccggatgtcagctggtcgctctgaacttc
cagaccatagatctgcccatgcagctgaatctgggcatctttgagtacaacgggaaatgc
ggctacagactgaagccagagttcatgcgacggacggacaaacagtttgacccgttcact
cagaatacagtcgacgggatcgtagcgcacacgctgtctgtgaagatcatatccggccag
tttctgtctgataagagagtcggtgtttacgtggaggtggaaatgttcggcctgccggtg
gacaccaaaaggaaagcgtttaagaccaagacgtctcaaggcaatgccgtcaatccggtg
tgggatgaagatccagtggtcttcaaaagagtggttcttcccacgctggcatcattgagg
atagctgtgtacgaagagaacgggaagtttatcggtcatcgcatcatcccagtgtgtgcc
atccgacccggatatcattacatcagtctgaggaacgagaagaaccagacgctgacgctt
ccgtccgtcttcatctacactgaggtcaaggactacgtcccagacacctttgcagacgtg
atcgaggccctgtccaatcccatcctgtacatcagtctgatggagcaaagagccaatcag
ctggcggctctgacacaagaggagggagcgcaggagaccgacagagaagaggtcagtggc
ggtggagatcctgtgtcagaggtcaagactgaccctaaacccgccgcagagtacgggctg
aatcacgacagcatctcgcccaaatcctccgtcgtcagtcaccagacgtcatcctcaggt
gtgtgtgtgtcagaggtggacgctcagtctgtagatgaactgaaacagatgaagggatat
ttgagggagcagaagaagcagtacaaagaactaaaggagctcatgaggaaacacaacaag
aaaacgaacgagctgattaacgaacacgcgtccagacagaagcagctgcgcaggtctgcg
ctgcagaagaggtgtgtgtcggatcaggatcaggatctgctggcgctggagcaggagagg
tgtgagaaactgaaggagcagcagcagcggcagctcctcacgctcagacaggagcagttc
tacagcgagaagtacctcaaacgagagcacgtcaaactgcttgttgagaagctcacggct
gtggcagaagagtgtcagaataaccagctgaagaaactgaaggatctgtgtgagaaagaa
aacaaagacttgaagaaaaggatggacaagagacgacaggagaagtttcaagaagcccga
acgctggagaagactctgactgaggagaaaaagatgaagatgaacagatcacacgtgaac
gaggtggtgcagtccatcaaacggctggaagaagctcaggacaaacgactggagagattg
ctggaaaaacataaagacattcgacagcaaatcctgggagacaaaccaaagcttcagagc
gagctggaccaggagtatcaggacaagtttcggaggctcccagcggaaatccaagagttc
gtgcaggactctgctgcttgtaaaggcaagttaagccaagacagtgactttcttcccatt
tccagaacgccggggaagctgaagccctcgctctcgccagctgaagatgtggagcgatct
tcagagaaagtcttcgacacaccactctga

KEGG   Sinocyclocheilus anshuiensis: 107659823
Entry
107659823         CDS       T04917                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4-like isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04621  NOD-like receptor signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Module
sanh_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107659823
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107659823
   04371 Apelin signaling pathway
    107659823
   04020 Calcium signaling pathway
    107659823
   04070 Phosphatidylinositol signaling system
    107659823
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107659823
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107659823
  09152 Endocrine system
   04912 GnRH signaling pathway
    107659823
   04916 Melanogenesis
    107659823
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107659823
   04270 Vascular smooth muscle contraction
    107659823
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107659823
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107659823
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107659823
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107659823
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6 MFA1_2
Other DBs
NCBI-GeneID: 107659823
NCBI-ProteinID: XP_016304355
LinkDB
Position
Unknown
AA seq 1243 aa
MTKSYEFNWQKHVPDFLQEGAVFDRFDEDPFVFEPSCHFKVDEFGFFLTWKSDGKEGQLL
ESSLINSVRPGVVPKDPKILASLEAAGKSEADLDGRIICVCSGPDLVNLSFMYMVTDNTD
TAKKWMEGLKSVIHNFKANNVCPMTCLKKHWMRLSFVTNVNGKIPVRCITRTFGSGKTEK
GIFQALKELGLPSGKNDEIEHSAFTFDIFYALTQKICPRTDIEELFKKINGDKSDYLTLE
QLVSFLNENQRDPRLNEILFPFYEAKRVMQIIEKYERDADLKKKGHMSSDGFCRYLMSDE
NAPVFLDRLDLCQEMEHPLAHYLISSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKDTAFVTSEYPVILSFENHCSKTQQYKM
AKYCEEIFGELLLKQPLEGFPVRDLFPRTQIQTFMENIEAGQPLPSPSDLKRKILIKNKR
LKPEVEQKQLESFKKHMEAGEMSIQTGEDENDEDLDSALEGKELNSDMKTSNTLSLSEDP
SDPDAQDSSLRKKIPDEDVTEISEATEITDATDVSEASELENKKKGVETAEDADAEQQLI
ASYKYEGATTNIHPYLSAMVNYAQPVKFQSFEVAEERNIHHNMSSFNESVGLGYLKTNAI
EFVNYNKRQMSRIYPKGGRVDSSNYMSSVFWNAGCQMVSLNFQTPDLGMQLNQGKFEYNG
ACGYLLKPDFMRRADRMFDPFSETPVDGVIAATCSVPQVFSGQFLSDKKIGTYVEVDMYG
LPTDTIRKEFRTRMVMNNGLNPYYNEEPFVFRKVILPDLAVLRIAVYDDNNKLIGQRILP
LDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGAIVDALSDPKKFLTIAEKR
ADQMRALGIETSDIADVPNESCKSDKKGKVSQVKTNVTPQSSSDVNATQNNVSENKRDNF
AILNLVNIEDLKQMKTFIKLMKKQQKELNTLKKRHAKEHNAMQKSHCTQVDRMVAQHDKE
KFSLEKLLEKAIKKRGENNCSELKKETAIKVETLTTDHKEKVKDIVAQHTKEWSEMINCH
STEEQEMKDAHVTQQCELLRKLLASVQEQQTLQLKLIHERQSKEMKGNQAKTSMENSKAI
SQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQAKELEQLQKSQREQLDKLEKFN
EQLLKSHHANSQTQGQRHAEDGEAGGGHGPQTSHGGVSAPPVN
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgaccaaatcatacgagttcaactggcagaaacacgttcctgacttcctgcaggaagga
gctgtgtttgaccgattcgatgaggatcccttcgtctttgagcccagctgccatttcaaa
gtcgacgagtttggcttctttctcacgtggaaaagtgacggaaaggaaggtcagcttcta
gaaagttctctgatcaacagcgtccgtcccggagtcgtgccgaaggacccgaagatcctg
gcgtctctggaagcggcggggaagagcgaggcggatctggacggtcgcatcatctgcgtc
tgcagtgggccggacctggtcaacctcagcttcatgtacatggtgacggacaacacggat
acggccaagaaatggatggaaggcctgaaatcagtgattcacaacttcaaggcgaataac
gtgtgtccaatgacgtgtctgaagaagcattggatgagactctccttcgtaacaaatgtc
aacggcaaaatcccggtccgatgcataacacggacgttcggctcgggtaaaacagagaag
ggaatcttccaggcgctgaaggagctcggtctccccagcgggaagaatgatgaaatcgag
cattcggccttcaccttcgacatcttctacgctctgacgcagaagatctgccctcgcacg
gacatcgaggagctcttcaagaagatcaacggagacaaaagtgattatttaaccttagag
cagttagtcagctttctgaatgaaaaccagcgggaccctcgactcaacgagatcctcttc
cccttttatgaagccaaacgagtcatgcagatcattgagaagtacgagagagacgccgac
ttgaaaaagaaaggtcacatgtccagcgatggcttctgccgctacctgatgtcagacgag
aatgcgccggtgtttctggaccgtctggatctgtgtcaggagatggagcatccgctggct
cattacttgatcagctcctcacacaacacctacctgacgggccggcagttcggcgggaag
tcctcggtggagatgtaccgacaggtgctgctgtctggatgcaggtgcgtggagctggac
tgctgggacggtaaaggtgaggatcaggagcccatcatcactcatggaaaggccatgtgc
accgacatcttgttcaaagatgtaattcaagccataaaggacacggcgtttgtaacgtct
gaatatcctgtcattctgtcgtttgagaaccactgcagtaaaacgcagcagtataagatg
gccaagtactgcgaggagatcttcggagagctgttgctgaagcagccgctggagggattc
ccagtacgtgatctattcccccgcacacagatccagaccttcatggaaaatatcgaagcc
gggcagccgctgccatcgcccagcgacctcaagcgcaaaatactcatcaagaacaagcgc
ttgaagcctgaagtggagcagaagcagctggagtcatttaagaagcacatggaggctgga
gagatgagcatacagaccggagaagatgagaacgatgaagatctggacagcgcgctggaa
ggtaaagagctgaactcagacatgaagaccagcaacactctatctctgtcggaggatccc
agcgatccggacgcacaggacagcagcctcaggaagaagatcccagatgaagacgtcacc
gagatctcagaagcgactgaaatcacggacgccaccgacgtgtccgaagcgtcggagctg
gagaacaagaagaagggtgtagaaacggctgaagatgctgatgccgagcagcagctcatc
gcctcgtataagtatgaaggagccacgaccaacatccacccgtacctgtcagcaatggtc
aactacgctcagcccgtcaagttccagagcttcgaggtcgccgaggagaggaacatccat
cacaacatgtcgtccttcaacgagtctgtgggtttgggctatctgaagacgaacgccatt
gagtttgtgaactacaacaagcggcagatgagccgcatctaccccaaaggaggccgcgtg
gactccagcaattacatgtcttctgtcttctggaacgccggctgccagatggtgtctctg
aacttccagactccagatctgggcatgcagctgaatcaggggaagttcgagtacaacggc
gcatgcgggtacctcctgaaaccagacttcatgcgccgcgctgacagaatgttcgacccg
ttctctgagacgccagtagatggagtgatagcagcgacctgcagcgttcctcaggtgttc
tcgggtcagttcttatcggataagaagatcggcacgtatgtggaggtggacatgtacggc
cttcccaccgacaccatccggaaagagttccgcacacgtatggtgatgaacaacggcctg
aacccgtactacaacgaggagcccttcgtcttcaggaaggtgatcctgccggatctggcc
gtgctgcgcatcgctgtgtacgacgacaacaacaagctgatcggtcagaggatcctgccg
ctagacggactgcaggcgggttaccgacacatctcgctgcgcaacgaggggaacaagccg
ctgtcactgcccaccgtcttctgcaacatcgtcctgaagacatatgtgccagatggcttc
ggcgccatcgttgacgctctttctgatccaaagaagttcctcaccatcgcagagaaacgc
gccgatcagatgcgagctctcgggatcgaaacgagcgacatcgcagacgttcccaacgaa
agctgcaagagcgataagaagggaaaagtgagtcaggtgaagaccaacgtgacgccgcag
agcagctccgatgtgaacgccacacagaacaacgtcagcgagaacaaacgcgataacttt
gccattttgaatctggtgaacattgaagatttgaagcagatgaagaccttcattaaactg
atgaagaagcagcagaaggaactgaacacgctaaagaaacgacacgctaaggaacacaac
gccatgcagaaatcacactgcacgcaggtggacagaatggtggctcagcatgacaaggag
aagttctcgctggagaagctgctggagaaggccatcaagaagagaggagaaaacaactgc
tccgagttaaagaaggaaacggccattaaggttgagacgctcacgacagaccataaagaa
aaggtgaaggacattgtggcgcagcacactaaagagtggtcagagatgatcaactgtcac
agcacagaggaacaagaaatgaaggacgcccatgtgacgcagcagtgtgagctcctcagg
aagctgctggccagcgttcaggagcagcagacactgcagctcaagctcatccacgagcgg
caaagcaaagagatgaagggcaatcaggcgaagacgtcgatggagaacagcaaagccatc
agccaggacaagagcatcaaaaacaaggcggagcgcgagaggagagttcgggagctgaac
agcagcaacaccaaaaagttcctggaggagagaaaaaggctggccatgaagcaggcgaag
gagctggagcagctgcagaagtctcagcgcgagcagctggacaaactcgagaagttcaac
gagcagcttttgaaatcacatcatgcaaacagtcagactcaaggccaaagacatgcagaa
gatggtgaagctggaggaggacatggaccgcagaccagccacggtggtgtaagcgctcca
cccgtcaactga

KEGG   Sinocyclocheilus anshuiensis: 107661090
Entry
107661090         CDS       T04917                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3-like
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04621  NOD-like receptor signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Module
sanh_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107661090
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107661090
   04371 Apelin signaling pathway
    107661090
   04020 Calcium signaling pathway
    107661090
   04070 Phosphatidylinositol signaling system
    107661090
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107661090
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107661090
  09152 Endocrine system
   04912 GnRH signaling pathway
    107661090
   04916 Melanogenesis
    107661090
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107661090
   04270 Vascular smooth muscle contraction
    107661090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107661090
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107661090
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107661090
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107661090
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y PH_14 EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 107661090
NCBI-ProteinID: XP_016306027
LinkDB
Position
Unknown
AA seq 1214 aa
MLLEAIPSLVTLKVDPDGFFLYWSGGTSMEVEVLDISQIRDTRTGRFAKMPKDQRIRDTL
GLGKGESNSDTKLLTVVYGNDLVNIFFLNFHAVQDGYCKVWTDELFKLATNILSQNASRN
IFLFKAYTKLKLQVNQDGKIPVKNILKMFSDKKRVEMALEHCGLVNNRVEGIKPDDFTWE
MFQNFLNKLSPRPEVERIFVELGSKGKPFLSLDQLMDFINRKQRDSRLNEVLYPPLKRDQ
VHQLMERYETNASQLERDQISLMGFTKYLGGEENSLVPPERLDIIDDMNQPLSHYFINSS
HNTYLTVGQLTGTSSVEMYRQVLLTGCRCIELDCWKGRPPEEEPIITHGFTMTTEISFKE
VIEAIAESAFKTSPYPLILSFENHVDSAKQQAKMAEYCRSMFGDALLIEPLEKYPLVPGQ
QLPSPQELMGKILIKNKKKHQHRASNGGSIRRKDGTDEQFSPLNDCPLSDGEVGQLMSNG
GEKLAERMAKDLDIRKSIDRGDGESEEEEEEEPIPDPKKHNNTDEGTAYSEVNATEEMST
LVNYIEPVKFKSFEAAAKRNKYFEMSSFVETKGMDTLKNSPSEFVEYNKKQLSRIYPKGT
RVDSSNYMPQLFWNVGCQMVALNFQTLDLPMQLNMGVFEYNGHCGYLLKPEFMRRTDKHF
DPFTVDIVDGIVANTVKIKIISGQFLNDKKVGVYVEVDMFGLPADTKRKYRTKTSNNNSL
DPVWDDETFVFNKVVLPTLASLRVAVYEENGKFIGHRILPVSALRPGYHYICLKNELNQP
LMLSSLLVYTEAQDYIPNEHQEYAEALTNPIKHLSLLAQRERQLLALMEDPTEGGPVKQD
EGDKFDSGCVTSVDPICPLPSPTPSVLTEVMNPPASGQKEDLVNNILKVIEPQSIDELKQ
HNSYLKLLKKQCKELKELKKKHLKKVWALSKEQRTRCSQLNSDLQRKRSQMEKRLRSSLK
KNGSEEVQRELNELDLEVQKQMDRFKEEQMQELLVLRHAQHQTEKEAKQFHLKEANQKLR
EIAQECQAAQIKKLKEVCDKEKKELQKILDRKRLNSIIEAKKAEKDKTEPELNEINKKHI
NESVNLIRQLELAQAKRQEKLKALHKDILQKIEEEVPVDQARLTCDCEAELKRLPEEISQ
YLQEIESKGSRKDTLMGQANDSSSSGPPSNCSTPPYSSPNHSWSNMANISSSMLDFSSTS
NTPVKSETDTTGVY
NT seq 3645 nt   +upstreamnt  +downstreamnt
atgttgttggaggccatacccagcctcgtcacccttaaagtggacccagatggattcttc
ctctactggtctggagggaccagcatggaagtggaagtcctggacatcagtcaaatcagg
gacaccaggacagggaggtttgccaagatgccaaaggaccaacgtatacgcgatacgctg
ggtttgggcaaaggagaaagcaactccgacacaaagctgctaactgtcgtctacggcaat
gacctggtcaacatcttcttcctcaacttccatgctgtgcaggatggctattgcaaggtg
tggactgatgagctgtttaaacttgccacaaacatactgtcccagaatgcttcccgcaac
atcttcttattcaaagcttacaccaagctgaagctgcaggtaaatcaggatgggaaaatc
ccagtgaagaacatcctgaaaatgttctcagataagaaacgtgtggagatggcgctggag
cactgcggcctggtcaataacagggtggagggtataaagccagatgacttcacctgggaa
atgttccagaactttctcaacaaactaagtcccagaccagaggtggagcgtatcttcgta
gagcttggctccaaagggaagcccttcctgtctctggatcagctgatggactttataaat
cgcaaacagagagattctcgactaaatgaggttctttacccaccactcaagcgagatcag
gtccaccagctcatggagagatatgagaccaacgccagccagctggagagagatcagatc
tccctgatgggcttcacaaaatatcttggtggggaggagaactctttggttcctcctgag
aggttggacatcatcgatgatatgaaccaacccctgtcccactatttcatcaactcttca
cacaacacatacctcacagtgggtcagttgacgggcacgtcatcagtggagatgtacagg
caggtgttgctgacaggatgccgctgtatagagctggactgctggaagggccgcccgcct
gaagaagagccaatcatcacgcacggttttaccatgacaactgagatctcgttcaaggaa
gtgatcgaggccatcgctgaaagtgcattcaagacgtctccctaccctctcatcctgtcc
tttgaaaatcatgtggactcggcaaagcagcaggctaaaatggcagagtactgtcgctct
atgttcggggatgcgctgctcatcgaacccctggagaaatatccgctggttcctggtcaa
caactgccaagcccccaggaactcatggggaagatcttgatcaagaacaagaagaaacat
cagcacagggcctctaatggtgggagcatcagacgcaaggacgggacagatgaacagttc
tcacctttgaatgattgtccattgtctgatggggaggtgggccagctcatgtccaatggg
ggagagaagcttgcagagaggatggccaaagatcttgatatccgcaagtctattgatcgg
ggagatggggagagtgaagaagaggaggaagaggaacccattccagatccaaagaaacac
aacaacactgatgagggtactgcgtacagtgaggttaatgctacagaggagatgtctaca
ctggtcaactatatagaacctgtcaaattcaagtcctttgaggcggcagccaagaggaat
aaatattttgagatgtcatcttttgtggagaccaaaggcatggacacattgaagaactct
cccagcgagtttgttgaatacaataaaaagcagctgagtcggatctaccccaaagggact
cgtgtggactctagtaactatatgccacagctcttctggaacgtgggttgccaaatggtg
gcactaaacttccaaactctcgacttgccgatgcagctgaacatgggggtgttcgaatat
aacggccactgtggttatctgctgaagccagagttcatgagacgcacggacaaacacttt
gacccctttactgtggacattgtggatggcatcgtagccaacacagttaaaatcaagatc
atctcaggtcagtttctgaatgataagaaagttggtgtttacgtggaggtggacatgttt
ggacttcccgcagacactaaaaggaaatatcgaacgaaaacttctaacaacaactctctg
gacccagtctgggatgatgaaacctttgtgttcaacaaggtggtgttgcccacccttgca
tctctgcgagtagcagtgtatgaagaaaatggaaagtttattggccatcgcatcttgcca
gtatcggcactgcgcccaggatatcactacatatgtctgaagaacgagctgaaccaaccg
ctcatgctgtcatccctacttgtgtacactgaggcacaagactacattcccaatgaacac
caagagtatgcagaggctctgacaaaccccatcaaacatctctctctgctggcccagaga
gaaaggcagctattagcacttatggaggatcccactgagggtggacctgtgaaacaagat
gaaggagacaagtttgactctggctgcgtgacctctgttgaccctatttgccctctgcca
tctccaacaccttctgtactcactgaggtcatgaaccctcctgcatcaggccaaaaagaa
gatttagtcaacaacattcttaaagtaatcgaacctcagtctattgatgagctcaaacag
cacaactcttacctgaagctgttgaagaagcaatgcaaggaactcaaggagctgaaaaag
aaacatctcaaaaaggtgtgggctctcagtaaggaacaaaggactcgctgtagtcagctg
aactctgacctccagaggaaacggagtcagatggagaagcgtctgcgctccagtctgaag
aaaaatgggtcagaggaggttcagagggaattgaatgagctggatctggaggtgcagaaa
cagatggaccggttcaaagaggagcagatgcaggagcttcttgtgcttagacatgcacaa
catcagacagagaaggaggctaaacaattccacctcaaagaggccaatcagaaactgagg
gaaatcgcccaagaatgccaagcagcccagatcaagaagctcaaggaagtgtgtgacaaa
gagaagaaagagttacagaagattctggacaggaagaggctgaacagcatcattgaggct
aagaaagcagaaaaggacaagactgagccggagttgaatgagatcaataaaaaacatatc
aatgagtcggtcaacttaatccgtcagctggaattggctcaagcgaagcgtcaagagaag
ttaaaagcccttcacaaggacatccttcagaaaatagaggaggaggttcctgtggatcag
gcccgtctgacatgcgactgcgaagcagagctgaagcgcttgccggaagagatctctcag
tatctgcaggagatcgagagcaaaggctcccgtaaagacactctgatgggtcaggccaat
gacagctccagctctggccccccctctaactgcagcacgcccccttattcctcccccaac
cacagctggagcaacatggccaatatctcgtcctcaatgctggacttctcctccacctca
aacactcccgtcaagtccgagacagatactacaggagtgtactag

KEGG   Sinocyclocheilus anshuiensis: 107661968
Entry
107661968         CDS       T04917                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3-like isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04621  NOD-like receptor signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Module
sanh_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107661968
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107661968
   04371 Apelin signaling pathway
    107661968
   04020 Calcium signaling pathway
    107661968
   04070 Phosphatidylinositol signaling system
    107661968
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107661968
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107661968
  09152 Endocrine system
   04912 GnRH signaling pathway
    107661968
   04916 Melanogenesis
    107661968
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107661968
   04270 Vascular smooth muscle contraction
    107661968
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107661968
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107661968
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107661968
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107661968
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y PH_14 EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 107661968
NCBI-ProteinID: XP_016307280
UniProt: A0A671P4S0
LinkDB
Position
Unknown
AA seq 1247 aa
MAGAKPGVHALQLKPVSVHEVLKRGSKFIKWDEEAIPTLVTLKVDPDGFFLYWSGGTSME
VEILDISQIRDTRTGRFARFPKDLRLRETLGLIKGDSYSESKLLTIVFGNDLVNLYFLNF
QAVQEGYCKVWTDELFKLATNILSQNASRNTFLFKAYTKLKLQVNQDGRIPVKTILKMFS
DKKRVEMALEHCGLVNNRADGIKPDYFTWEMFQNFLNKLSPRPEVERIFVELGSKGKPFL
SLDQLMDFINRKQRDSRLNEVLYPPLKRDQVHQLMERYETNTSQLERDQISLMGLAKYLG
GEENSVVPPERLDLIDDMNQPLSHYFINSSHNTYLTVGQLTGTSSVEMYRQVLLTGCRCI
ELDCWKGRPPEEEPIITHGFTMTTEISFKEVIEAIAESAFKTSPYPLILSFENHVDSAKQ
QAKMAEYCRTMFGDALLIEPLEKYPLDPGQQLPSPQELMGKILIKNKKKHHHRASNGGSI
RRKDGTDEQSSPLNDCPLSDGEVGQLMSNGGEKLAERMAKDLDIRKSIDQGDGESDEEEE
EEPIPDPKKHNNTDEGTAYSEVNATEEMSTLVNYIEPVKFKSFEAASKRNKYFEMSSFVE
TKGMDTLKNSPMEFVEYNKKQLSRIYPKGTRVDSSNYMPQLFWNVGCQMVALNFQTLDLP
MQLNMGVFEYNCHCGYLLKPEFMRRTDKHFDPFTMGIVDGIVANTIKIKIISGQFLNDKK
VGVYVEVDMFGLPADTKRKCRTKTSNNNSLDPVWDDETFVFNKVVLPTLASLRVAVYEEN
GKFIGHRILPVSALRPGYHYICLKNELNQPLLLSSLLVYTEAQDYIPNEHQEYAEALTNP
IKHLSLLAQRERQLLALMEDPTEGGPVKQEEGDKFDSGFVTSIDPICPLPSPIIPSVLTE
VLNPPASGQKEDLVNNILKVIEPQSTDELKQHNSYLKLLKKQCKELKELKKKHLKKMWAL
SKEQRTCCNQLNSDLQRKRSQVEKRLRSSLKKNGSEEPVQRELNVLNLELQKQMEQFREE
HMLKLLALRQAQHQTEKEDKQFHLKEANQKLREIALECQATQIKKLKEVCDKEKKELQRI
LDRKRLNSIIEAKKAEKDKAEARELNEINRKHISDSVNLISQLEVSQGKRQEKLKALHKD
ILQKIEEEVPMDQARLTRDCEAELKLLPEEISQYLQELESKGSRKDTLMDQANDSPSSGP
PSNCSTPPYSSPNHSWSSMGNISPSLLDPSSTSNTPVKSETDTTGVY
NT seq 3744 nt   +upstreamnt  +downstreamnt
atggctggggcgaaaccgggagtacacgcgttgcagctcaaaccggtgtctgtccatgag
gtgctcaaacgggggagcaagtttatcaaatgggacgaggaggccatacccaccctcgtc
acccttaaagtggacccagatggattcttcctctactggtctggagggaccagcatggaa
gtggaaatcctggacatcagtcaaatcagggacaccaggacagggaggtttgccaggttt
ccaaaggacctacgtttacgtgagacgttgggtttgatcaaaggagattcctactccgaa
tcaaagctgctaactatcgtcttcggcaatgacctggtcaacctctacttcctcaacttc
caagctgtgcaggagggctattgcaaggtgtggactgatgagctgtttaaacttgccaca
aacatactgtcccagaatgcttcccgcaacaccttcttattcaaagcttacaccaagctg
aagctgcaggtaaatcaggatgggagaatcccagtgaagaccatcctgaaaatgttctca
gataagaaacgtgtggagatggcactggagcactgcggtctggtcaataacagggctgat
ggtataaaaccagattacttcacctgggaaatgttccagaactttctcaacaaactaagt
cccagaccagaagtggagcgtatcttcgtggagcttggctccaaagggaagcccttcctg
tctctggatcagttgatggactttataaatcgcaaacagagagattctcgactaaatgag
gttctttacccaccgctcaagcgagatcaggtccaccagctcatggagagatatgagacc
aacaccagccagctggagagagatcagatctccctgatgggcttggcaaagtatcttggt
ggggaggagaactctgtggttcctcctgagaggttggacctcatcgatgatatgaaccaa
cccctgtcccactatttcatcaactcttcacacaacacatacctcacagtgggtcagttg
acgggcacgtcatcagtggagatgtacaggcaggtgttgctgacaggatgccgctgtata
gagctggactgctggaagggccgcccacctgaggaagagccaatcatcacgcacggtttt
accatgacaacagagatttcattcaaggaagtaattgaggccatcgctgaaagtgcgttc
aagacgtctccctaccctctcatcctgtcctttgaaaatcatgtagactcggcaaagcag
caggctaaaatggcagagtattgtcgcactatgttcggggacgctctgctcattgaaccc
ctggagaaatatccactggatcctggtcagcaactgccaagcccccaggaactcatgggg
aagatcttgatcaagaacaagaagaaacatcaccacagggcctctaacggtgggagcatc
agacgcaaggacgggacagacgaacagtcctcacccttgaatgattgtccattgtctgat
ggggaggtgggccagctcatgtccaatgggggcgagaagcttgcagagaggatggccaaa
gatcttgatatccgcaagtctattgaccagggagatggggagagtgatgaagaggaggaa
gaggaacccattccagatccaaagaaacacaacaacactgatgagggtactgcatacagt
gaggtgaacgctacagaggagatgtctacgttggtcaactacatagaacctgtcaaattc
aaatcctttgaggcggcatccaagaggaataagtattttgagatgtcatcttttgtggag
accaaaggcatggacacattgaagaactctcccatggagtttgttgaatacaataaaaag
cagctgagtcgcatctaccccaaagggacgcgtgtggactctagcaactatatgccacag
ctcttctggaacgtgggttgccaaatggtggcattaaacttccaaactctcgacttgccg
atgcaacttaacatgggggtgtttgaatataactgccactgtggttatctgctcaagccg
gagttcatgagacgcacggacaaacactttgacccctttactatgggcattgtggatggc
atcgtagccaacacaattaaaatcaagatcatctcaggtcagtttctgaacgataagaag
gttggtgtttacgtggaggtggacatgtttggacttcctgcagacactaaaaggaaatgt
cgaacgaaaacatctaacaacaactctctggacccagtctgggatgatgaaacctttgtg
ttcaacaaggtggtgttgcccaccctagcatctctgcgagtagcagtgtatgaagaaaat
gggaagtttattggccatcgtatcttgccagtatcggcactgcgcccaggatatcactac
atctgtctgaagaatgagctgaaccaaccgcttttgctgtcatccctgcttgtgtacact
gaggcacaagactacattcccaatgagcaccaagagtatgcagaggctctgacaaacccc
atcaaacatctctctctgctggcccagagagaaaggcagctattagcacttatggaggat
cccactgagggtggacctgtgaaacaggaggaaggagacaagtttgactctggcttcgtg
acctctattgaccctatctgccctctgccgtctccaataattccttctgtgctcaccgag
gtcctgaaccctcctgcatcaggccaaaaagaagatttagtcaacaatattcttaaagta
atcgaacctcagtccactgatgagctcaaacagcacaactcctacctgaagctgttgaag
aagcaatgcaaggaactcaaagagctgaaaaagaaacatctcaaaaagatgtgggctctc
agtaaggaacaaaggacttgctgtaatcagctgaactctgacctccagaggaaacggagt
caggtggagaagcgcctgcgttccagtctgaagaaaaatgggtcagaggagccggtgcag
agggaattgaacgtgctgaatctggagctgcagaaacagatggagcagttcagagaggag
cacatgctgaagcttcttgcacttagacaggcacaacatcagacagagaaagaggataaa
caattccacctcaaagaggccaatcagaaactgagggaaatcgccctagaatgccaagca
acccagatcaagaaactcaaggaagtgtgtgacaaagagaagaaagagttacagaggatt
ctggacaggaagaggctgaacagcataattgaggccaagaaagcagaaaaggacaaggct
gaggccagggagctgaatgagatcaatagaaaacatatcagtgattcggtcaacttaatc
agtcagctggaagtgtctcaagggaagcgtcaagagaagttaaaagcccttcacaaggac
atccttcagaaaatagaggaggaggttccaatggatcaggcccgtctgacacgcgactgc
gaggcagagctgaagctattgccagaggagatctcacagtacctgcaggagctcgagagc
aaaggctctcgtaaagacactctgatggatcaggccaatgacagccccagctccggcccc
ccctctaactgcagcacgcccccttattcctcccccaaccacagctggagcagcatgggc
aatatctcgccctcactgctggacccctcctccacctcaaacactcctgtcaagtcagag
acagatactacaggagtgtactag

KEGG   Sinocyclocheilus anshuiensis: 107663134
Entry
107663134         CDS       T04917                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2-like
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04621  NOD-like receptor signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Module
sanh_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107663134
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107663134
   04371 Apelin signaling pathway
    107663134
   04020 Calcium signaling pathway
    107663134
   04070 Phosphatidylinositol signaling system
    107663134
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107663134
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107663134
  09152 Endocrine system
   04912 GnRH signaling pathway
    107663134
   04916 Melanogenesis
    107663134
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107663134
   04270 Vascular smooth muscle contraction
    107663134
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107663134
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107663134
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107663134
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107663134
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y PLC-beta_C EF-hand_like DUF1154 C2
Other DBs
NCBI-GeneID: 107663134
NCBI-ProteinID: XP_016308779
LinkDB
Position
Unknown
AA seq 1216 aa
MNRNRYALQEPDVKEYLVKGDRFTKWKEDSKKTTPVTMKMDPKGFYLYWINQSKETEFLD
IVTIRDTRAGKYAKLPKHPKVRNVFNMDFPDSHHLAKALTIVTGPDTISLSYHNFFAAKE
VAQTWADDILAIAYNTLRSNACRQVFLEKVYVRLSLQTNKDGKIPVKNILKMFPADKKRV
EAALAAANLPKGKFDTIKSDVFTDAAFKTFILNLCPRPEINEIFTSLXGKGFMTKEMLAK
FLNEKQRDSRLNEELFPLVRPEQVKNLIEKYEPSSSNASRGQISPDGLMFYLMGSETSVV
KLDKLAQSHDMTQPIPHYFVKSSHNTYLTAGQLTGVSSPEMYRQCLLAGCRCLELDCWKG
KPPDEEPIITHGFTMTTEILFKDVIEAIAESAFKTSKYPVVLSFENHVDTVKQQEKMAYY
CRTIFGDALLVDVLDKYPLKPGHPMPSPSELMGKILIKNKKSSAPASKPEQAKKASGPEQ
ANASADDSESNQPADPNQPAPANPEASDLPHAAAAPDEREEHDDHDEQDEEKMKNSDEGT
AGQEVTAYEEMSALVNYVQPNKFISFENAAKKNKSFVISSFVETKGESLIAKNAVDWVEY
NKRQMSRIYPKGTRVDSSNYSPQPFWTAGCQFVALNYQTMDFPMQLNMALFEFNGRTGYL
LKHDVVRRSDKTFDPFTDRIDTIIASTLTIKIYSGQFLSDKHVKTGVEVELIGLPKDPKR
KYRTKMSTTPNAINPEWNEEPFVFEKILLPEMAYLRLVVQEEGGKFLGHRIIPLDALQTG
FQHICLRNEGNMPLTLPSLFVHIEVKDYIPAAFADFSDALFNPVKTSKPPKTESLTYVCE
YELPLADGAQTPAAEPKAAEEAPASSEAEAEAAVTPAEGDAAPPAEQTPAPEPEPEPKPE
EKPEPEPKPEEKPEPEPKPEERPEPEPKPEEKPEPEPEPEEKPETEPEPEPKPEEKTEPD
PEPKSEENPEAAADAVVTETKESSEETPSDPSDITTVTCEELQQHKNFLKVAKKQEKELK
DTEKKFQKKREELIQKYSDQFRALKKKKSGDDPGDQMNELKQKLKSELRALLVEQHDQIK
KKKEQNNTERLTKLLEMATEVYGNEPKKKDKMKKCKSTEQLDNDNAQSADNSSADGSPQE
QSLKKKQAATLASIRDLISQLNKDAVAEHAKKMWSLPSELSEAVNSCVQPHFPELVEKAG
ESRSENTGQYNHVFVG
NT seq 3651 nt   +upstreamnt  +downstreamnt
atgaatcgaaaccgctacgcgcttcaggagcctgatgtcaaagaatacctggtgaaggga
gacaggttcacaaaatggaaagaagactccaagaaaaccacaccggtcaccatgaagatg
gatccgaagggattttacctgtattggatcaatcagagcaaggaaactgagtttttggat
atcgtcaccatcagggacacaagagcgggaaaatatgccaaactccctaaacatccaaag
gttcgtaacgtcttcaacatggattttcctgacagccatcatctggccaaagcgctgacc
atcgtgacgggaccagacaccatcagcctctcctatcacaacttcttcgctgctaaagaa
gtggctcagacgtgggcagacgacattctggctatagcatataacacactgagatcaaac
gcctgcagacaggtcttcctggagaaagtgtatgtccgactctcattgcagaccaacaaa
gatggaaaaattcctgttaaaaacatcttaaagatgtttccagcagacaagaaaagagtg
gaagctgctctggctgcagcaaatctcccgaagggaaagtttgacaccattaagtctgat
gtgttcactgacgcggccttcaagaccttcatactcaatctctgtcccagacctgaaatc
aatgaaatcttcacgtccttgtgaggaaagggtttcatgacgaaggagatgctggccaag
tttctgaacgagaaacagcgagattcccgtctcaatgaggagctgtttccactcgtcaga
cccgaacaggtgaagaatctcatagagaaatatgagccgagctcgtccaacgccagccgc
ggtcagatttctccagatggtttgatgttttatctgatgggatctgaaacatcagtggtg
aaactggacaaactggcccagagtcacgatatgactcaaccaatcccacattacttcgtc
aaatcctcccacaacacctatctcacagctgggcagctgacgggcgtctcgtctccggag
atgtaccgccagtgtctcctcgccgggtgccgctgtctggagctcgactgctggaagggc
aaacctccggatgaagagccaatcatcacccacggcttcaccatgacaaccgagatcctc
ttcaaggatgtgattgaagcgatcgctgagagtgccttcaaaacgtccaagtatcctgtt
gtcctttcgtttgagaaccacgtcgatacagtgaagcagcaggagaagatggcctactac
tgcaggacaatctttggagacgctctgctcgttgacgtactggacaaatatcccctgaag
ccgggtcatccgatgccgagtccgtctgagctgatgggtaaaatactgatcaagaataag
aaaagcagcgcacctgccagcaaaccagaacaggccaagaaagcgtctggtccagagcaa
gcaaacgcatctgcggacgactctgagtccaaccagccggccgatccaaaccaacccgct
ccagctaacccagaggccagcgacctgccgcatgcagccgccgctccagatgagcgtgaa
gagcatgatgaccacgatgaacaggacgaagagaagatgaagaactctgatgagggaacc
gctggacaggaagtgacagcatacgaggagatgtccgctctggtcaactacgtacagccc
aacaaattcatctcttttgagaacgcagccaaaaaaaacaagagttttgtcatctcttcc
ttcgtggaaaccaaaggggagagtctgatcgctaagaacgctgtggactgggtcgaatat
aataagaggcagatgagtcgtatctaccctaaaggaacccgtgtggactcttcgaactac
agtccacaacccttctggaccgccggctgccagtttgtggcgctcaactaccagactatg
gatttccccatgcagctcaacatggctctgtttgagtttaacggcaggacgggttacctc
ctcaaacacgacgtggtccgtcgcagcgacaagacgttcgatcccttcaccgacaggatt
gacaccattatcgccagcactctcaccattaagatttactccggtcagttcctgtcggat
aagcacgtgaaaaccggagtggaggtcgagctcatcggtttgcccaaagaccccaaacgc
aaataccgcaccaaaatgagcacgacgcccaacgccatcaaccccgagtggaacgaggag
cctttcgtcttcgagaagatcttgctgccggagatggcttacctcagacttgtggttcag
gaggagggcggcaagttcttgggtcaccgaatcatccctctggacgctctgcaaacaggt
ttccagcacatctgtctgcgcaacgagggcaacatgccgctcacgctgccgtctctgttc
gttcacatcgaggtgaaggactacatccccgctgcattcgccgatttctcagatgcactt
ttcaatcctgtgaagacttcaaagccaccgaagactgagagtttaacatacgtgtgtgaa
tatgagttacctctggctgacggagcccagacacctgccgcagaaccgaaggccgcagaa
gaagctccagcatcatcagaggctgaagctgaagctgcagtgactccagcagagggcgac
gctgcacctccggcagaacagactccagcgccagaacctgaacctgagcccaaaccagag
gaaaaaccagaaccagagcccaaaccagaggaaaaaccagaacctgagcccaaaccagag
gaaagaccagaaccagagcccaaaccagaggaaaaaccagagccagaacccgaaccagaa
gaaaaaccagagacagagccagaacccgaacccaaaccagaggaaaaaactgaaccagac
cctgaaccaaaatcagaagaaaacccagaagctgctgcagatgctgttgtcacggagacc
aaagaatccagtgaggaaaccccatctgatccatcagatatcaccactgtgacctgtgaa
gaactgcagcagcacaagaacttcctgaaagtcgccaagaaacaggagaaagagctgaaa
gacacggagaagaagtttcagaagaaacgagaagaactgattcagaaatacagcgaccag
ttcagagccttgaagaagaagaagtctggagatgatccgggtgaccagatgaatgaactc
aagcagaagctgaagtcggagctcagggctctgctggtggagcaacacgatcaaatcaag
aagaagaaagaacaaaacaacactgagcgtttgaccaaactcctggaaatggccacagaa
gtctatggaaatgagcccaagaagaaagacaaaatgaagaaatgcaaaagtacggagcag
cttgacaacgataacgcacagtcggcagataacagcagcgctgatggttcaccgcaggaa
cagagtctgaagaagaaacaggccgctacactggccagcatcagagatctgatcagtcag
ctgaataaagacgccgtggccgaacacgccaagaagatgtggtctctgcccagtgagctg
tccgaggccgtcaactcctgcgtccagccgcatttcccagagcttgtggagaaggccggc
gagagccgctccgaaaacaccggacagtacaaccatgtgttcgtaggatga

KEGG   Sinocyclocheilus anshuiensis: 107663155
Entry
107663155         CDS       T04917                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1-like isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04621  NOD-like receptor signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Module
sanh_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107663155
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107663155
   04371 Apelin signaling pathway
    107663155
   04020 Calcium signaling pathway
    107663155
   04070 Phosphatidylinositol signaling system
    107663155
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107663155
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107663155
  09152 Endocrine system
   04912 GnRH signaling pathway
    107663155
   04916 Melanogenesis
    107663155
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107663155
   04270 Vascular smooth muscle contraction
    107663155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107663155
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107663155
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107663155
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107663155
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 DUF4277
Other DBs
NCBI-GeneID: 107663155
NCBI-ProteinID: XP_016308802
LinkDB
Position
Unknown
AA seq 1220 aa
MAGAQPGVHALQLKPVCVSESLKRGSRFMKWDEDSSTVTPVTLRVDPQGYFLYWTDQNKE
TDLLDITYIKDARTGKCTKTPKEAKLRELLDVGNLVGRIENRMLTVVTGPDMVNIQYLNF
MAFQEDVAKEWADELFSLASNLLAQNMGRESCLEKAFTRLKLQTNQEGRIPVKNIFRMFS
TDRKRVETALESCNLPSGRNDSIPLEDLTPDVYKSFINNLCPRSEINQIFADLGAKNRNY
LTVDQMTEFINSKQRDPRLNEILYPPLKPEQTQLLIEKFEPNAAGIQNGQISVEGFARYL
ISEENSVIPPEKLDQSEDMTFPLSQYFINSSHNTYLTAGQLAGNSSVEMYRQTLLSGCRC
VELDCWKGRTAEEEPVITHGFTMTSEISFKEVIEAIAECAFKTSPFPVILSFENHVDSPK
QQAKMAEYCRSIFGDALLTETLEKYPLESGVPLPSPHELVGKILIKNKKSHPKPSDGSTK
KKLSEQASNTNSDSSSVFEPSSPSTGPAALASAEVEAEDDEDEDDDDDDCKKSMDEGTAG
SEAFATEEMSTLVNYIQPTKFHSFEISKKSKRSYQMSSFVETKALEHLTKTPVEFVEYNK
FQLSRIYPKGTRVDSSNYMPQVFWNAGCQLIALNFQTIDLSMQLNLGMYEYNGKSGYRLK
PEFMRRPDKHFDPFTESTVDGIVANTLSVKIISGQFLTDKKVGVYMEIDMFGLPVDTRRK
AFKTKTSQSNAINPVWDEEPSVFKKVVLPTLASLRIAVYEEGGKFIGHRIIPVSAIRPGY
RYIGLRNEKNQALTLPAIFVYIEVKDYVPDTFADVIEALSNPIRYVNLMEQRSKQLAALT
LEEGEEEKDTKEVDPGVENPSEVKSEPKPVPVENGLSHAPSAAPKPASQISPQPQSTGST
KPAAKTEDLIQSVLTEMEAQTVEELKQQKGFVREQRRHYKEMKDLVKKHHKKTTEMIKEH
TAKYNEFQHDYLRKRAVLLKSAKRDGKKRCLSSNPEHGASFFEQELANLDQDSGQKLSEL
KEQQQQQLLNLRQEQYYSEKYLKKEHIKQVIEKLTAIAEESQSNQMKKIKELCEKEKKEL
KKKMDKKRQEKISEAKSKEKHLTEEEKLEINRSYVNEVVQHIKRLEDAQTKRHEKLVETH
KSILQQILDEKPKLQNDLDQEYQDKFRRLPLEIQEFVQESTKRKTEDGEQEVLPSSSSTL
EKLMQKGAQSEDDTEEEKKD
NT seq 3663 nt   +upstreamnt  +downstreamnt
atggctggagctcaacctggcgttcatgcgcttcaactcaagccggtgtgcgtgtccgag
agtctgaagcgaggcagtagatttatgaaatgggatgaggattcgtctacggtgactcca
gtgacgttgcgcgtcgatccgcagggatacttcctgtactggacagatcagaataaggaa
acagatctattggacatcacctacatcaaagatgcaagaacggggaaatgcaccaaaacg
ccaaaggaggcgaagctgcgggagctgctggatgtggggaatctggtgggccggatagag
aaccggatgctgacggtggtgacggggccagacatggtcaacatccagtacctgaacttc
atggccttccaagaagatgtcgccaaggagtgggcagatgagctcttcagtctggcgtct
aacctgctcgctcagaacatgggccgagagtcctgtctggagaaagccttcacgagactc
aagctgcagacgaatcaggagggtcgaatcccagtgaaaaacatcttccgcatgttctcg
actgaccggaagcgcgtggagacggcgctggagagctgcaatcttccgtccggccggaac
gactccatccctttggaggatttgacgcctgatgtttacaaatcgttcatcaacaacctc
tgcccacgatctgagatcaaccaaatatttgctgatctcggcgcgaagaacagaaactat
ctgacggtggatcagatgacagaattcatcaacagcaagcagcgagacccgcgtctgaac
gagatcctgtacccaccgctcaaacctgagcaaacccagctgctcatagagaagttcgag
cccaacgcagcggggattcagaacgggcagatctcagtggagggcttcgccaggtatctg
atcagtgaggagaacagcgtcattccaccagaaaaactggaccagagtgaagacatgacc
ttccctctctctcagtacttcatcaactcgtcccacaacacctacctcacagctgggcag
ctcgcggggaactcctctgttgagatgtaccggcagacgctgctgtctggctgtcgctgt
gtggagctggactgctggaagggccggacggcggaggaggaacccgtcatcacacacggc
ttcaccatgacctcagaaatctccttcaaggaagtgatcgaagccatagcagagtgcgct
tttaagacgtctccgttccccgtcatcctgtcctttgagaatcatgtggactcccccaaa
cagcaagccaaaatggcagaatattgccgatcgatattcggggacgctcttttgactgag
actctggagaaatatcctcttgagtccggcgttcctctgccaagccctcatgagctcgtg
ggaaagatcctcatcaagaacaagaaatctcaccccaaaccctcagacggcagcactaag
aagaagctgtccgagcaggcgtccaacaccaacagcgactcgtccagcgtctttgagccg
tcgtctcccagcactggacccgcagctttagcgtctgcagaggtggaggctgaggatgat
gaggatgaagatgatgatgatgatgactgtaagaagtccatggacgagggtacagcagga
tctgaagcctttgccactgaagaaatgtccacgctggtcaactacatccagcccaccaag
ttccactcgtttgagatttccaagaagagcaaacgcagttatcagatgtcatcgttcgtg
gagaccaaagcgctggagcatctcaccaagacaccggtggagtttgtcgaatacaacaag
tttcagctgagcaggatttatcctaaaggaacgcgcgtggattcctccaactacatgccg
caggtcttctggaacgccggctgtcagctcatagcactcaactttcagaccatcgatctg
tccatgcagctgaacctcggcatgtacgagtacaacggcaagagcggctacagactcaaa
ccagagttcatgagacgaccggacaagcacttcgaccccttcacagaaagcactgtggac
ggcatcgtagccaacaccttatcagtgaagatcatatcaggacagtttctgactgacaag
aaggtgggtgtttatatggagattgacatgtttggactccccgtcgacaccagacgaaaa
gctttcaagacaaagacgtcccagagcaatgccatcaaccctgtgtgggacgaggagccc
agcgtctttaaaaaagtggttttgcccacgctggcatccctcaggatagccgtgtatgaa
gagggcggcaagttcatcggccatcgcatcatccccgtctcagccattcgtccgggttat
cgttacatcggattgagaaatgaaaagaatcaagcgctgactcttcctgctatatttgtg
tatatcgaggtgaaagactatgttcctgatacattcgccgatgtcatcgaagcgctgtcc
aaccccatcagatacgtcaacctgatggagcagagatccaaacagctggcggcgctcact
ctagaggagggagaagaggagaaagacaccaaagaggtggatcctggtgttgaaaaccct
tcggaggttaaaagcgaacccaaacccgtcccggttgagaacggcctgagtcacgcgccc
agcgccgctccgaaacccgcgtcccagatcagcccacagccgcagtccacaggctcaacc
aaaccagcggcaaagactgaagatctgattcagagcgtcctcaccgagatggaggcgcaa
accgtcgaggagctcaaacagcagaagggcttcgtccgagagcagagacgacattataaa
gagatgaaggacctggtgaagaaacaccacaagaagaccaccgagatgatcaaggagcac
acggccaaatacaacgagttccagcacgactacctgcgcaaacgagccgtcctgctgaag
tctgccaaacgagacggtaagaagaggtgtttgtcgtccaatcctgaacacggagcctcg
ttcttcgagcaggagctggccaatctggatcaggacagcggacagaaactctctgaactc
aaagaacagcagcagcagcagctcctcaatctgcgtcaggagcagtattacagcgagaaa
tatctgaagaaagagcacatcaaacaggtgatcgagaagctgacggccatcgctgaggag
agtcagagcaaccaaatgaagaaaatcaaggagctgtgtgagaaagaaaagaaagagctg
aaaaagaaaatggacaagaagagacaagagaagatcagtgaagccaaatccaaggagaaa
cacctgaccgaagaggagaagctggagatcaacaggtcgtatgtgaacgaggtggtgcag
cacatcaagaggctggaagacgctcagactaaaagacacgagaagctggtagaaactcat
aagagcatcctgcaacagatattagacgagaaacccaagctccagaacgacctggatcag
gaataccaggacaaattccggcggcttcctctggagatccaggagtttgtgcaggaaagc
accaagagaaagactgaggacggagagcaggaggttcttccctcttcctcctccacgctg
gagaaactcatgcagaagggagcacagtctgaagacgacacagaggaggagaagaaagac
tga

KEGG   Sinocyclocheilus anshuiensis: 107663156
Entry
107663156         CDS       T04917                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4-like isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04621  NOD-like receptor signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Module
sanh_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107663156
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107663156
   04371 Apelin signaling pathway
    107663156
   04020 Calcium signaling pathway
    107663156
   04070 Phosphatidylinositol signaling system
    107663156
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107663156
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107663156
  09152 Endocrine system
   04912 GnRH signaling pathway
    107663156
   04916 Melanogenesis
    107663156
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107663156
   04270 Vascular smooth muscle contraction
    107663156
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107663156
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107663156
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107663156
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107663156
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y PH_14 DUF1154 EF-hand_like
Other DBs
NCBI-GeneID: 107663156
NCBI-ProteinID: XP_016308805
LinkDB
Position
Unknown
AA seq 1175 aa
MAKPYEFNWQRPVPHFMLEGAYFDRFDEDPLVFEPNCFFKVDAFGFFLTWKSEGKEGQVL
EFSLINSVRDASVPKDPKILSALEAAGKCESNLEDRIICICSGTDLVNLSFMCMVTQNSS
TAKQWMDGLRSLIQNSRANNVCPMTCLRKHWMRLSFLTNVNGKIPVRSITRTFASGKTEK
GIFQALKDLGLPSGKNDEIEHEIFKFDKFYSLTQKICPRTDIEALFKTLRGDKSDYLSVD
QLVHFLNENQRDPRLNEILFPFFDSKCAFQIIQRYEPDDKLKRKGLMSCDGFCRYLMSDE
NAPVFLDRLEVYQEMDHPLSHYFINSSHNTYLTGRQFGGKSSVEMYRQVLLTGCRCVELD
CWDGKGEDQEPIITHGKAMCTDVFFKDVIQGIKETAFLTSEYPVILSFENHCTKHQQYKL
ARYCEDIFGDLLLKQPLDDFPMEAGSPLPSPNDLKGKILIKNRRLKPEVEKKQLEHFRKH
MEAGEPSISTNMSEDENEEETSTAELLNEAHPERIHGCLITEEENREEEALRPRKAGETN
VADEQALIQSYTYVAATTNIHPYLSNIVNYAQAVKFTSFDEAEEKNIHPNMSSFNESVGL
GYLRTNAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVAVNFQTPDLAMQLN
QGKFEYNGSCGFLLKPDFMRRPDRMFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTY
VEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYSGEAFVFRKVILPDLAVLRVAVYDDNNKL
IGQRILPLDGLQSGYRHISLRNEYNKPLSLATVFCSIILKTYVPDGFGAIADALSDPKKF
LSVCEKRTDQMRAMGIEMSDIADVPNDGWMGNRKRRAMLQQKDSERLRAAPGQNPLICCK
EDTSVLAPQLTIDDLKQTKTYLKLVKKQQKDVSALKKKQAKAHVALQSSHCTQVDRTVAQ
HDKEKQALEKQLEKSIRKVSDSYSLDMSRDIERQIKTLTSNHKSKVKDMVAAHALEWAEM
IKWHSAEEQTVREQHVIQQCEMLRKLLLMEQEQQTQQLSFLHERQNKEMRTNQAKTSMES
SKTISQDKSIKNKAERERRVRELNSTNTRKFLTERKRLAMKQSKESEQLQAAQREQLERL
EKHNEELLNPCYAKSQCQGQRESQHEDGREDPTER
NT seq 3528 nt   +upstreamnt  +downstreamnt
atggcgaaaccatatgagttcaactggcagcggcctgttcctcatttcatgctggaagga
gcatattttgacagatttgatgaggatccgcttgtctttgaaccaaactgttttttcaaa
gtggatgcttttggattcttcctgacgtggaaaagtgagggaaaggagggtcaagtttta
gagttttcccttatcaacagcgtacgagatgccagtgtgccaaaggacccaaagatcctc
tcggcgttggaggccgcgggaaaatgtgagagtaacctggaggacagaatcatctgcata
tgcagcggcacagacctcgttaacctgagcttcatgtgcatggtcacgcaaaacagcagc
actgctaagcaatggatggacggcttgcgatcattgattcagaactctcgagcgaataac
gtgtgtccgatgacctgcctgagaaaacattggatgcggttgtcatttttgaccaatgtg
aatggaaaaatacccgtcaggagtatcacacgaacctttgcctcgggcaaaacagagaag
ggtattttccaggcgctgaaggatctcggtttacccagtggaaagaacgatgaaatcgag
catgaaatcttcaaatttgacaagttctacagccttacgcagaagatttgtcccagaact
gatattgaagcactgttcaagacactcaggggagacaaaagcgattatttaagcgtagac
cagttagtccactttttgaatgaaaatcagagagatccgcgtctgaatgaaatactcttc
ccgttcttcgactctaaatgtgctttccaaatcatacagcgatatgaacctgatgacaaa
ctgaagaggaaaggtctgatgtcatgtgacgggttctgccgatatctgatgtctgatgaa
aacgctcctgtgtttctggaccgcctggaggtttatcaggagatggatcatccgctgtct
cactacttcatcaactcgtctcacaacacgtacctgaccggcagacagtttggagggaag
tcgtcagtggagatgtacagacaggtgctgctgaccggctgcaggtgtgttgagttggac
tgctgggatggaaaaggtgaagatcaggagcccataatcacccacggcaaggccatgtgc
acagacgtcttcttcaaggacgtcattcagggaattaaagaaacggccttcctgacatca
gagtatccggtgattctgtccttcgaaaaccactgcacgaaacatcagcagtataaactg
gcgcgctactgcgaggacatttttggagatttgctcctgaaacagccgttagatgatttc
ccgatggaggccgggtctccgctgccgtctccaaatgacctcaaaggaaaaatccttatc
aagaatagaagattaaaacctgaagttgaaaaaaaacagctggagcacttcaggaagcac
atggaggccggagagccgagcatctccacaaacatgtctgaagatgagaatgaggaggag
acatccaccgcagagctgctgaacgaagctcatcccgagcggattcacggatgtctgatc
actgaggaagagaatcgtgaggaagaggcgctccgacccagaaaggctggtgaaacgaat
gtggctgacgaacaagcactgattcagtcgtacacgtatgtggcggccactactaacatc
cacccgtatctgtccaatatcgtcaactacgcacaggccgtcaagttcaccagctttgat
gaagccgaagaaaaaaatatccaccccaacatgtcttccttcaacgagtctgtcggtttg
ggatatttaaggacaaacgccattgaattcgtgaactacaacaaacggcagatgagtcgc
atctaccccaaaggaggccgagtggactccagtaattatatgccacagatcttctggaac
gccggctgccagatggtagcagtgaacttccagaccccagatttggcgatgcagctcaac
caagggaaatttgaatataatggctcatgtgggtttctgctgaagcctgatttcatgcgg
cggcccgatcgcatgttcgacccgttctcagagacgccggtggacggagtgatcgccgcc
acatgcagcgtccaggtgatttcaggccagtttctgtcggataagaagatcggcacatac
gtggaggtggacatgtacggcctgcccacagacaccatccgtaaagagtttcgcacgagg
atggtgatgaacaacggcctgaatcccgtctacagcggagaagccttcgtcttcaggaag
gtgatcctcccagacctggctgtgctgcgcgtggccgtgtatgacgacaacaataagctg
ataggacagcgcattctcccgctggacggactgcagtcgggttacaggcacatctcccta
cgaaacgagtacaacaagcctctgtctctggccaccgtcttctgcagcatcatcctcaag
acatacgtgcccgacggcttcggagcgattgcagatgccctgtctgatcccaagaagttc
ttatcggtctgtgagaagagaaccgaccaaatgagagccatgggcattgagatgtcagat
atcgccgatgtgccgaatgacggctggatggggaacaggaagcggagggcaatgctgcag
cagaaagactcagagagactgagagcagcaccgggacagaacccactcatctgctgcaaa
gaggatacatcagtgctcgcacctcagctgaccatcgatgacctaaagcaaaccaagacc
tacttgaagctcgtcaagaagcagcagaaggacgtgagcgctttgaagaaaaagcaggcg
aaggcccacgtcgcactgcagagctcccactgcactcaagtggacaggactgtcgctcaa
catgataaagagaaacaagcactggagaagcagctcgagaaaagcatcaggaaagtgagt
gacagttacagccttgacatgagcagagacatcgaaaggcagatcaagactttaacgagc
aatcacaaatcaaaggtgaaggacatggtggccgctcacgcgctcgaatgggcagaaatg
atcaaatggcactcggctgaagagcagactgtgagagagcagcatgtgattcagcagtgc
gagatgctccggaaactcctgctgatggagcaggagcagcaaacccagcagctctcgttc
ctccatgagagacagaataaagagatgcgaaccaaccaagcgaagacctcgatggagagc
agcaaaaccatcagtcaagacaaaagcataaagaacaaggctgagagggaacggagagtt
cgagagcttaacagcacgaacacaaggaagtttcttacagaaagaaagaggctcgccatg
aaacagtccaaggagagcgagcaactccaggcagctcagcgggaacaactggagaggctg
gagaaacacaatgaggagctgttgaacccgtgctatgcaaaatcacaatgccaaggccag
agagagtcccagcatgaagacggcagagaggacccaacagagcgctga

KEGG   Sinocyclocheilus anshuiensis: 107678713
Entry
107678713         CDS       T04917                                 

Gene name
plcb2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04621  NOD-like receptor signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Module
sanh_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107678713 (plcb2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107678713 (plcb2)
   04371 Apelin signaling pathway
    107678713 (plcb2)
   04020 Calcium signaling pathway
    107678713 (plcb2)
   04070 Phosphatidylinositol signaling system
    107678713 (plcb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107678713 (plcb2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107678713 (plcb2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107678713 (plcb2)
   04916 Melanogenesis
    107678713 (plcb2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107678713 (plcb2)
   04270 Vascular smooth muscle contraction
    107678713 (plcb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107678713 (plcb2)
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107678713 (plcb2)
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107678713 (plcb2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107678713 (plcb2)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y PLC-beta_C EF-hand_like DUF1154 C2
Other DBs
NCBI-GeneID: 107678713
NCBI-ProteinID: XP_016329569
LinkDB
Position
Unknown
AA seq 1176 aa
MNRNRYTLQEPDVKEYLVKGDRFTKWKEDSKKTTPVTMKMDPKGFYLYWINQSKETEFLD
IATIRDTRAGKYAKLPKHPKVRNVFNMDFPDSHHLAKALTIVTGTDTVSLSYHNFFAAKE
VAQTWADDILAIAYNTLRANACRQFFLEKVYVRLSLQTNKDGKIPVKNIFKMFPADKKRV
EAALAAANLPKGKFDTIKSDVFTEAAFKTFILNLCPRPEINEIFTSFTKGKGFMTKEMLT
KFLNEKQRDSRLNEELFPLVRPEQVKNLIEKYEPSSSNASRGQISPDGLMFYLMGSETSV
VKLDKLAQSHDMTQPIPHYFVKSSHNTYLTAGQLTGVSSPEMYRQCLLAGCRCLELDCWK
GKPPDEEPIITHGFTMTTEILFKDVIEAIAESAFKTSKYPVVLSFENHVDSVKQQEKMAN
YCRTIFGDALLVDVLDKYPKKKKKTFENNSILCLTAPDEREEHDDHDEQDEEKMKNSDEG
TAGQEVTAYEEMSALVNYVQPNKFISFENAAKKNKSFVISSFVETKGESLIAKNAVDWVE
YNKRQMSRIYPKGTRVDSSNYSPQPFWTAGCQFVALNYQTMDFPMQLNMALFEFNGRTGY
LLKHDVVRRSDKKFDPFTDRIDTIIASTLTIKIYSGQFLSEKHVKTGVEVELIGLPKDPK
RKYRTKWSTTPNAINPEWNEEPFVFEKILLPEMAYLRLVVQEEGGKFLGHRIIPLDALQT
GFQHICLRSESNMPLTLPSLFVHIEVKDYIPAAFADFSDALFNPVKTSKPPKTEVEAIME
TKAAEEAPAEGDAAPPAEQTPAPEPAKPEKKPEPEPKPEEKPEPEAKPEEQPEPEPKPEE
KPEPEAKPEEQPEPEPKPEEKPEPEAKPEEQPEPEPKPEEKPEPEAKPEEKPEPETKPEE
NTEPEPDPEPKSEENSEPAAAADAVVTETKESTEETPSDPSDPTTVTCEELQQHKNFLKV
AKKQEKDLKDMEKKFQKKREELIQKYSDQFKALKKKSTGKKSGDDPGDQMNELKQKLKPE
LRALLVEQHDQTKKKKEQNNTERLTKLLEMATEKHCSEVKALNSEPKKKDKMKKCKSTEQ
LDNDNAQSANNSSADGSPQEQSLKKKQAATLASIRDLISQLNKDAVAEHAKKMWSLPGDL
SEAVNSCVQPHFPEHVEKAGENHSENTGQYSHVFVG
NT seq 3531 nt   +upstreamnt  +downstreamnt
atgaatcgaaaccgctacacgcttcaggagcctgatgtcaaagagtacctggtgaaggga
gacaggttcacaaaatggaaagaagactccaagaaaaccacaccggtcaccatgaagatg
gatccgaaaggattttacctgtactggatcaatcagagcaaggaaacagagtttttggat
attgccaccatcagggacacaagagcgggaaaatatgccaagctccctaaacatccaaag
gttcgtaacgtcttcaacatggattttcctgacagccatcatctggccaaagcgctgacc
atcgtgacaggaacagacaccgtcagcctctcctatcacaacttctttgctgctaaagaa
gtggcccagacgtgggctgacgacatcctggctatagcatataacacactgagagcgaac
gcctgcagacagttcttcctggagaaagtgtatgtccgcctctcactgcagaccaacaaa
gatgggaaaatccctgttaaaaatatctttaagatgtttccagcagacaagaaaagggtt
gaagctgctctggccgcagcaaatctccccaaaggaaagtttgacaccatcaagtctgat
gtgttcactgaagcggcgttcaagaccttcatactcaatctgtgtcccagacctgaaatc
aatgaaatcttcacgtccttcacgaaaggaaagggattcatgacgaaggagatgctgacc
aagttcctgaacgagaaacagcgagattcccgtctcaatgaggagctgtttccactcgtc
agacctgaacaggtgaagaatctcatagagaaatacgagccgagctcgtccaacgccagc
cgcggtcagatttctccagatggtttgatgttttatctgatgggatctgagacatcagtg
gtgaaactggacaaactggcccagagtcacgatatgacccaacccatcccacattacttc
gtcaaatcctcccacaacacctatctcacagcggggcagctgacgggcgtctcgtctccg
gagatgtaccgtcagtgtctcctcgccgggtgccgctgtctggagctcgactgctggaag
ggcaaacctccggatgaagagccaatcatcacccacggcttcaccatgacaaccgagatc
ctcttcaaggatgtgattgaagcgatcgctgagagcgcctttaaaacatccaagtatcct
gtggtcctttcctttgagaaccacgttgattcagtgaagcagcaggagaagatggccaac
tactgcaggacgatctttggagacgctctgctcgttgacgtactggacaaatatcctaaa
aaaaaaaaaaaaacctttgaaaataacagtattttgtgtctaactgctccagatgagcgt
gaagaacatgatgaccacgatgaacaggatgaagagaagatgaagaactctgatgaggga
accgctggacaggaagtgacagcgtatgaagagatgtcagctctggtcaactacgtgcag
cccaacaaattcatctcttttgagaacgcagccaaaaaaaacaagagttttgtcatctct
tccttcgtggaaaccaaaggggagagtctgatcgctaagaacgcagtggactgggtcgaa
tataataagagacagatgagtcgtatctaccctaaaggaacccgtgtggactcttcgaac
tacagtcctcagcccttctggaccgccggctgccagtttgtggcgctcaactaccagact
atggatttccccatgcagctgaacatggctctgtttgagtttaacggcaggacgggttac
ctcctcaaacacgatgtggtccgtcgcagcgacaagaagttcgatcctttcactgacagg
attgacaccattatcgccagcactctcaccattaagatttactccggtcagttcctgtcg
gagaagcacgtgaaaaccggagtggaggtcgagctcatcggtttgccgaaagaccccaag
cgcaaatatcgcaccaaatggagcacgacacccaacgccatcaaccccgagtggaacgag
gagcctttcgtcttcgagaagatcttgctgccggagatggcttacctcagactcgtggtt
caggaggagggaggcaagtttttagggcaccgaatcatccctctggatgctctgcagaca
ggtttccagcacatctgtttgcgcagcgagagcaacatgccgctcacgctgccgtctctg
ttcgtgcacatcgaagtgaaggactacatccctgctgcattcgccgatttctcggatgca
cttttcaatccagtgaagacttcaaagcctccaaagactgaggtagaggctattatggaa
acgaaggctgcagaagaagctccagcagagggcgacgctgcacctccggctgaacagact
ccagctccagaaccagccaaaccagagaaaaaaccagaacccgaaccaaaaccagaggaa
aaaccagaacctgaagccaaaccagaggaacaaccagaacctgaaccaaaaccagaggaa
aaaccagaacctgaagccaaaccagaggaacaaccagaacctgaaccaaaaccagaggaa
aaaccagaacctgaagccaaaccagaggaacaaccagaacctgaaccaaaaccagaggaa
aaaccagaacctgaagccaaaccagaggaaaaaccagaacccgaaacaaaaccagaggaa
aacactgaaccagaaccagaccctgaaccaaaatcagaagaaaattcagaacctgctgca
gctgcagatgctgtcgtcacggagaccaaagaatccactgaggaaaccccatctgatcca
tcagatcccaccactgtgacctgtgaagaactgcagcagcacaagaacttcctgaaagtc
gccaagaaacaggagaaagacctgaaagacatggagaagaagtttcagaagaaacgagaa
gaactgattcagaaatacagcgaccagttcaaagccttgaagaagaagagcacgggcaag
aagtctggagatgatccaggtgatcagatgaatgaactcaagcagaagctgaagccggag
ctcagggcgctgctggtggagcaacacgatcaaaccaagaagaagaaagaacaaaacaac
accgagcgtttgaccaaactcctggaaatggccaccgagaagcactgcagtgaggtcaag
gcactcaacagtgagcccaagaagaaagacaaaatgaagaaatgcaaaagtacggagcag
cttgacaatgataacgctcagtcggcaaataacagcagcgctgatggttcaccgcaggaa
cagagtctgaagaagaaacaggccgctacgctggccagcatcagagatctgatcagtcag
ctgaataaagacgccgtggccgaacacgcgaagaagatgtggtctttgcccggtgacctg
tccgaggccgtcaactcctgcgtccagccgcatttcccagagcatgtggagaaagccgga
gagaaccactctgaaaacaccggacagtacagccatgtgttcgtaggatga

KEGG   Sinocyclocheilus anshuiensis: 107678738
Entry
107678738         CDS       T04917                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1-like
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04621  NOD-like receptor signaling pathway
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Module
sanh_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107678738
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107678738
   04371 Apelin signaling pathway
    107678738
   04020 Calcium signaling pathway
    107678738
   04070 Phosphatidylinositol signaling system
    107678738
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107678738
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107678738
  09152 Endocrine system
   04912 GnRH signaling pathway
    107678738
   04916 Melanogenesis
    107678738
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107678738
   04270 Vascular smooth muscle contraction
    107678738
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107678738
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107678738
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107678738
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107678738
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 DUF4277
Other DBs
NCBI-GeneID: 107678738
NCBI-ProteinID: XP_016329601
LinkDB
Position
Unknown
AA seq 1201 aa
MAGAQPGVHALQLKPVRVSESLKRGSRFMKWDEDSSTVTPVTLRVDPQGYFLHWTDQNKE
TDLLDITYIKDARTGKCTKTPKEAKLRELLDVGNLVGRIENRMLTVVTGPDMVNIQYLNF
MAFQEDVAKEWADELFSLASNLLAQNMGRESCLEKAFTRLKLQTNQEGRIPVKNIFRLFS
TDRKRVETALESCNLPAGRNDSIPLEDLTPDVYKSFINNLCPRSEINQIFADLGVKSRNS
LTVDQMTEFINNKQRDPRLNEILYPPLKPEQTQLLMEKFEPNPAMIQRGQISVEGFARYL
ISEENSVIPPEKLDQSEDMTFPLSQYFINSSHNTYLTAGQLAGNSSVEMYRQTLLSGCRC
VELDCWKGRTAEEEPVITHGFTMTSEISFKEVIEAIAECAFKTSPFPIILSFENHVDSPK
QQAKMAEYCRSIFGDALLTETLEKYPLEPGVPLPSPQELIGKILVKNKKSHPKPSDGSTK
KKLSEQASNTNSDSSSVFEPSSPSAGPAGLAPAEVEAEDDEDEDDDDDDCKKSMDEGTAG
CEAFATEEMSTLVNYIQPTKFHSFEISKKSKRSYQMSSFVETKALEHLTKTPVEFVEYNK
FQLSRIYPKGTRVDSSNYMPQVFWNAGCQLVALNFQTIDLSMQLNLGMYEYNGKSGYRLK
PEFMRRPDKHFDPFTESTVDGIVANTLSVKIISGQFLTDKKVGVYVEIDMFGLPVDTRRK
AFKTKTSQSNAINPVWDEEPIIFKKVVLPTLASLRIAVYEEGGKFIGHRIIPVSAIRPGY
RYIGLRNEKNQALTLPAIFVYIEVKDYVPDTFADVIEALSNPIRYVNLMEQRSKQLAALT
LEEGEEEKDTKEADPGVENPSEVKSEPKPVPVENGLSHTPSSAAPKPVSQISSQPQSTGS
TKPAAKTEDLIQSVLTEMEAQTVEELKQQKGFVREQRRHYKEMKDLVKKHHKKTTEMIKE
QSAKRDGKKRCLSSSPEHGASFFEQELANLDQDSGQKLSELKEQQQQQLLNLRQEQYYSE
KYLKKEHIKQVIEKLTAIAEDSQSNQMKKIKELCEKEKKELKKKMDKKRQEKISEAKSKE
KHLTEEEKLEINRSYVNEVVQHIKRLEDAQTKRHEKLVETHKSILQQILDEKPKLQNDLD
QEYQDKFRRLPLEIQEFVQESTKRKTEDGEQEVLPSSSSTLEKLMQKGAQSEDDTEEEKK
D
NT seq 3606 nt   +upstreamnt  +downstreamnt
atggctggagcacaacctggcgtccatgcgcttcaactcaagccggtgcgcgtgtctgag
agtctgaagcgaggcagcagatttatgaaatgggatgaggattcttctacggtgactcca
gtgacgttacgcgtcgatccgcagggatacttcctccactggacggatcagaataaggag
acagatctattggacatcacctacatcaaagatgcaagaacggggaaatgcaccaaaacg
ccaaaggaggcgaagctgcgggagctgctggatgtggggaatctggtgggccggatagag
aaccggatgctgacggtggtgacggggccagacatggtcaacatccagtacctgaacttc
atggccttccaagaagacgtcgccaaggagtgggcagatgagctcttcagtctggcgtct
aacctgctcgctcaaaacatgggccgagagtcctgtctggagaaagccttcacgagactc
aagctgcagacgaatcaagagggtcgaatcccagtgaaaaacatcttccgcttgttctcg
accgaccggaagcgtgtggagacggcgctggagagctgcaatcttccggccggccggaac
gactccatccctttggaggatttgacacctgatgtttacaaatcgttcatcaacaacctc
tgcccacgatctgagattaaccaaatatttgctgatctcggcgtgaagagcagaaactct
ctgacagtggatcagatgacagaattcatcaacaacaagcagcgggacccgcgtctgaac
gagatcctgtacccgccgctcaagcccgaacaaacccagctgctcatggagaagtttgag
cccaacccagccatgattcagagagggcagatctcagtggagggcttcgccaggtatctg
atcagtgaggagaacagcgtcattcctccagaaaaactggaccagagtgaagacatgacc
ttccctctctctcagtacttcatcaactcctcccacaacacttacctcacagcggggcag
ctcgcggggaactcctctgttgagatgtaccggcagacgctgctgtctggctgtcgctgt
gtggagctggactgctggaagggccggacggcggaggaggaacccgtcatcacacacggc
ttcaccatgacctcagaaatctccttcaaggaagtgatcgaagccatcgctgagtgtgcg
ttcaagacgtctccgttccccatcatcctgtcctttgagaatcacgtggactcccccaaa
cagcaagccaaaatggcagaatattgccgatccatattcggggacgctcttttgactgag
actctggagaaatatcctctcgagccaggcgttcctctgccaagccctcaagagctcatt
ggaaagatcctcgtcaagaacaagaaatctcaccctaaaccctccgatggcagcactaag
aagaagctgtccgaacaggcgtccaacacaaacagcgactcgtccagcgtctttgagccg
tcctcacccagcgctggacccgcaggtttagcacctgcagaggtggaggctgaggatgat
gaggatgaagatgatgacgatgatgactgtaagaagtccatggacgagggtacagcagga
tgtgaagcctttgccactgaagaaatgtccacgctggtcaactacatccagcccaccaag
ttccactcgtttgagatttccaagaaaagcaaacgcagttatcagatgtcgtcgttcgtg
gagaccaaagcgctggagcatctcaccaagacgccggtggagttcgtcgaatacaacaag
tttcagctgagcaggatttatcctaaaggaacgcgtgtggattcctccaactacatgccg
caggtcttctggaacgccggctgtcagctcgtcgcactcaactttcagaccatcgatctg
tccatgcagctgaacctcggcatgtacgagtacaacggcaagagcggctacagactcaaa
ccagagttcatgagacgaccggacaagcacttcgaccccttcacagaaagcactgtggat
ggcatcgtagccaacaccttatcagtgaagatcatatcaggacagtttctgactgacaag
aaggtgggcgtttatgtggaaattgacatgtttggacttcccgttgacacgagacgaaaa
gctttcaagacaaagacatcccagagcaacgccatcaaccctgtgtgggacgaggagccc
atcatctttaaaaaagtggtgttgcccacgctggcgtccctcaggatagccgtgtatgaa
gagggtggcaagttcatcggccatcgcatcattcccgtctcagccattcgtccgggttat
cgttacatcggtttgagaaatgaaaagaatcaagctctaactcttcctgctatatttgtg
tatatcgaggtgaaggactacgttcccgatacattcgccgatgtcatcgaagcgctgtcc
aaccccatcagatacgtcaacctgatggagcagagatccaaacagctggcggcgctcact
ctagaggaaggagaagaggagaaagacaccaaagaggcagatcctggtgttgaaaaccct
tcggaggttaaaagcgaacccaaacccgtcccggttgagaacggactgagtcacacaccc
agcagcgccgctcctaaacccgtgtcccagatcagctcacagccacagtccacaggctca
accaaaccagcggcaaagactgaagatctgattcagagcgtcctcaccgagatggaggcg
caaaccgtcgaggagctcaaacagcagaagggcttcgtccgagagcagagacgacactat
aaagagatgaaggacctggtgaagaaacaccacaagaagaccaccgagatgatcaaggag
cagtctgccaaacgagacggtaagaagaggtgtttgtcgtccagtcctgaacacggagcc
tcgttcttcgagcaggaactggccaatctggatcaagacagcggacagaaactgtccgaa
ctcaaagaacagcagcagcagcagctcctcaatctgcgtcaggagcagtattacagcgag
aaatatctgaagaaagagcacatcaaacaggtgatcgagaagctgacggccatcgctgag
gacagtcagagcaaccaaatgaagaaaatcaaggagctgtgtgagaaagaaaagaaagag
ctgaaaaagaaaatggacaagaagagacaagagaagatcagtgaagccaaatccaaggag
aaacacctgaccgaagaggagaagctggagatcaacaggtcgtatgtgaacgaggtggtg
cagcacatcaagaggctggaagacgcgcagactaaaagacacgagaagctggtagaaacc
cacaagagcatcctgcagcagatattagacgagaaacccaaactccagaatgacctggat
caggaataccaggacaaattccggcggcttccactggagatccaggagtttgtgcaggaa
agcaccaagagaaagactgaggacggagagcaggaggttctgccctcttcttcctccacg
ctggagaaactaatgcagaagggagcacagtctgaagacgacacagaggaggagaagaaa
gactga

DBGET integrated database retrieval system