KEGG   Sinocyclocheilus anshuiensis: 107659894Help
Entry
107659894         CDS       T04917                                 

Definition
(RefSeq) DNA ligase 1-like isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh03030  DNA replication
sanh03410  Base excision repair
sanh03420  Nucleotide excision repair
sanh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107659894
   03410 Base excision repair
    107659894
   03420 Nucleotide excision repair
    107659894
   03430 Mismatch repair
    107659894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sanh03032]
    107659894
   03400 DNA repair and recombination proteins [BR:sanh03400]
    107659894
Enzymes [BR:sanh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107659894
    6.5.1.6  DNA ligase (ATP or NAD+)
     107659894
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107659894
DNA replication proteins [BR:sanh03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107659894
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107659894
DNA repair and recombination proteins [BR:sanh03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107659894
   NER (nucleotide excision repair)
    Other NER factors
     107659894
   MMR (mismatch exicision repair)
    Other MMR factors
     107659894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 107659894
NCBI-ProteinID: XP_016304483
LinkDB All DBs
Position
Unknown
AA seq 989 aa AA seqDB search
MQRSIASFFQPMKSKEKSDGQVKAKTEPVKSPLKIQNGMQESDSPVKKVHKRSRAIIDSD
DEDQPIVKEQVPKQSEVEPVKPEKKSDVTKAASTPVSPKTPITPTTPVTSSTSVAVVTPA
SSGTPGTPATPTSTSPSGIPKRKTARKQFPKRKLESRSDGEGAKEEGKEVDEGQESKRAR
VEASPGQTDNEMMEVEEKSADGKTAVEEQKEKDEAKTTVVEDNANNKMKEKVKNKVKQEK
KINVENGKKEKKEDNKEKEHSSPERAVKKEKNTEEEGGSAKKKPISSFFAPRKAAVKLEK
EERNEGEKKKDGEISDAAEQKEKKRLNEKGVDSAVQSQYDPSRAHYHPVDHACWRKGQKV
PYLAVARSFEKIEEDSGRLKNIETLSNFLRSVILLSPDDLLCCVYLCLNQLGPAYQGLEL
GIGETVLMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPANLTAGGVFNK
LKEIANMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLTALSQAV
CLSPPGQEFPPAVLNAGKGMSAENRRVWLEEKALILKQTYCEMPNYDAIIPVLMKEGIDE
LPNHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERAQIHILENGELRIF
SRNQEDNTSKYPDIISRIPQVKKENVRSCVLDSEAVAWDREKKQIQAFQVLTTRKRKDVD
ASEIKVQVCVYAFDLLYLNGASLVREPLSKRRALLRESFEEKEGEFVFARSLDSDNTESI
AEFLEQSVRDSCEGLMVKTLEKHATYEIAKRSHNWLKLKKDYLEGVGDTVDLCVIGAYLG
KGKRAGSYGGFLLACYDEENEEFQSVCKIGTGFKDEDLEQHYNFLKEHILPKPRPYYRVD
QSAEPDVWLEAVQVWEVKCADLSLSPVYKAAMGLVDPEKGISLRFPRYLRIRDDKKPEDA
TTGSQIADLYKKQQQIQNQGEKQDLEDYY
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatcgcgtcattctttcagccaatgaaaagtaaggagaagagtgatgga
caggtcaaagcaaagactgaacctgtaaaaagtcccctcaaaattcagaatggtatgcag
gaaagcgattcaccagtaaagaaggttcataaacgcagtcgagcaatcatagacagcgat
gatgaagatcagccgatagtaaaagagcaggtgccaaaacagagtgaagttgaaccagta
aagccagagaagaaatctgatgttacaaaggctgcttccactccggtttctccaaaaaca
cccataaccccgacgactccggtcacgtcgagtacctctgttgcggtggtaacccctgct
tcctcaggtactccgggaactccagcaactccgacatcaacatcgccgtcaggcattccc
aaacgcaagaccgcccgcaagcagttccccaagaggaagctggaaagcagaagtgatgga
gagggggcaaaagaggaggggaaggaggtcgacgaagggcaggagagtaagagagcacga
gttgaggcctcacctggacagacagacaatgagatgatggaggtggaagagaagagcgca
gatgggaagactgcagtggaggaacagaaagagaaggatgaagcaaaaacaaccgtagtt
gaggacaatgcaaacaataagatgaaagaaaaggttaaaaataaggtaaaacaggagaaa
aagataaatgtagaaaatgggaagaaagaaaaaaaagaagacaacaaagagaaggaacat
agcagtcccgaacgagcggttaaaaaagaaaaaaacacagaggaggaagggggatcggcc
aaaaagaaacccatcagcagcttttttgctcccagaaaggcagctgtcaaactggaaaaa
gaggagcgaaatgagggagaaaaaaagaaggatggggagatctctgatgctgctgaacag
aaagagaagaaaaggttgaatgaaaagggggtggattctgcagtccagagccagtatgat
ccctccagagcacattaccatcccgttgaccacgcctgctggaggaagggccaaaaagtg
ccatatttggctgtcgctcgcagttttgagaagattgaagaggattcgggcaggctgaag
aacattgaaacgctttccaactttctgcgatctgtaattctgctttctccagatgacctg
ttatgctgtgtgtacctgtgtctgaatcagctcggccctgcatatcagggtctggagctg
ggcattggggagaccgtcctgatgaaagctgtcgctcaagcaactgggcgacaactggac
aaaatcaaggcggaggctcaggagaaaggtgacctgggattggttgctgaaagttctcgc
agcaaccagagaatgatgtttgcaccggccaatctgacagcagggggcgttttcaacaaa
ctgaaagagattgctaacatgagtggaaattctgcaatgaataagaagattgacattatt
aaaggcttgtttgtggcgtgtcggttttctgaggctcgatacattgtgcggtcactggct
gggaagctgcggatcggattggctgagcagagcgttctcacggctctcagtcaggctgtg
tgtctgtcgcccccgggccaagagttcccaccagctgtgctgaatgcagggaaaggaatg
agtgcagaaaaccggagagtgtggctggaggagaaagcactgatcctaaaacagacatac
tgtgagatgccaaattatgatgcaatcattcctgttttgatgaaggagggcatagatgaa
ctgcccaatcactgcaagctcaccccaggtgtgcccctgcgaccaatgttggctcacccg
actaaaggggttggtgaggtaatgaaacgtttcgatgaggcagctttcacctgcgagtat
aaatatgatggagagagagcccagatccatattcttgagaatggagagttgcgcattttt
agccgaaaccaagaagacaacacaagcaaataccctgatattatttctcgaatcccacag
gtgaagaaagagaacgtgcggtcctgtgttctggattcagaggcggtggcctgggacaga
gaaaagaaacagatccaggcatttcaggtcctcaccacaaggaagagaaaggatgtggat
gcatctgagatcaaggttcaggtgtgtgtgtacgcctttgatctgctgtacctcaacgga
gcgtctctggtgcgagagcctctaagcaaacgcagggctctgttacgagagagttttgag
gagaaagaaggagagtttgtttttgctcgatctctggactctgacaacacagagagcatt
gctgagttcctggagcagtctgtacgagattcttgtgagggcctaatggtgaagacactg
gaaaaacatgcaacttatgagattgccaaacgctcccacaactggctcaagctgaagaag
gactatctggagggtgttggagacacagtggatctgtgtgtgattggtgcttatctaggg
aaggggaagagagcaggcagctatggaggatttctactggcctgctacgatgaggagaac
gaggagttccagtctgtctgcaagattggaacaggcttcaaagatgaagatctagagcaa
cattacaatttcttaaaggagcacattttacctaaaccacgtccatattaccgtgtggac
caatcagcagagccagatgtctggctggaggcggtgcaagtgtgggaggtgaaatgcgct
gacctttcactgtctccggtctacaaggcagcgatgggattggtggacccagagaaaggc
atttcacttcgtttcccacggtacctcaggattagagatgacaaaaagccagaggatgcc
accacagggtcacagattgcagatctttacaagaaacagcagcagattcaaaatcagggt
gaaaaacaagatctggaggactactattga

DBGET integrated database retrieval system