KEGG   Sinocyclocheilus anshuiensis: 107661717
Entry
107661717         CDS       T04917                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107661717
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107661717
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sanh04052]
    107661717
   00536 Glycosaminoglycan binding proteins [BR:sanh00536]
    107661717
Cytokines and growth factors [BR:sanh04052]
 Growth factors
  Growth factors (RTK binding)
   107661717
Glycosaminoglycan binding proteins [BR:sanh00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107661717
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107661717
NCBI-ProteinID: XP_016306948
UniProt: A0A671KLB8
LinkDB
Position
Unknown
AA seq 158 aa
MTERHITAFTLLPSTTEQKDPKHNSLQKLYCRNGGYHLRIQPNETVDASRQENDVYTLLK
VKAVKAGLVAIRGHETGLYLAMDKYGKLHGTVMLNDECYFIEKIEENHYNTYRSQRYQEN
GDWYVGIKKNGWAKNGSKTHKGQNAIYFLPIPVDNSIQ
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaccgagcggcatatcaccgctttcacactcctaccgtcgaccaccgagcagaaagat
cccaaacataactctctgcaaaaactttactgcaggaatggaggataccatctccggatc
caacctaacgagactgtggacgcgagtcgacaagagaacgacgtttacactcttttaaag
gtaaaagcagtgaaagcaggattagtagccattaggggtcatgagactggactatacctg
gcaatggacaaatatggaaaacttcatggcactgtcatgttgaacgatgagtgttacttc
attgagaagatagaggagaaccactacaacacataccgctcacagaggtatcaggagaac
ggagactggtacgtggggatcaaaaagaatggatgggcaaaaaacggctccaaaacacac
aagggccaaaatgcaatctacttcctgccaattccagtggataacagcatacagtaa

DBGET integrated database retrieval system