KEGG   Sinocyclocheilus anshuiensis: 107662045Help
Entry
107662045         CDS       T04917                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00010  Glycolysis / Gluconeogenesis
sanh00053  Ascorbate and aldarate metabolism
sanh00071  Fatty acid degradation
sanh00280  Valine, leucine and isoleucine degradation
sanh00310  Lysine degradation
sanh00330  Arginine and proline metabolism
sanh00340  Histidine metabolism
sanh00380  Tryptophan metabolism
sanh00410  beta-Alanine metabolism
sanh00561  Glycerolipid metabolism
sanh00620  Pyruvate metabolism
sanh01100  Metabolic pathways
Module
sanh_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107662045
   00053 Ascorbate and aldarate metabolism
    107662045
   00620 Pyruvate metabolism
    107662045
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107662045
   00561 Glycerolipid metabolism
    107662045
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107662045
   00310 Lysine degradation
    107662045
   00330 Arginine and proline metabolism
    107662045
   00340 Histidine metabolism
    107662045
   00380 Tryptophan metabolism
    107662045
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107662045
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107662045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107662045
NCBI-ProteinID: XP_016307391
LinkDB All DBs
Position
Unknown
AA seq 516 aa AA seqDB search
MLRTVFSRPFPQVFRISACQHSTIPAPNVHPDVHYNKIFINNEWHDAVSKKKFPTINPAT
GEVICHVAEGDKADVEKAVKAAKDAFKLGSPWRRMDASHRGLLLSRLADCIERDAAYLAE
LETLDNGKPYAVSYTVDVPMVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPIGVCGQ
IIPWNFPLLMQAWKLGPVLATGNTVVMKVAEQTPLTALYVASLIKEVGFPAGVVNIVPGM
GPTAGAAIASHMDVDKVAFTGSTEVGHLIMKASSTSNLKKVTLELGGKSPNIVLSDANME
EAVEQSHFALFFNQGQCCCAGSRTYVQESIYDEFVERSVERAKKRIVGDPFNFNTEQGPQ
VDEEQFQKILGYISSGKREGAKLMCGGGPAADRGYFIQPTIFGDVKDDMTIAREEIFGPV
MQILKFKSLEEVIERANDSKYGLAAAVFTKNIDKAHYISNGLRAGTVWINCYDVFGVQAP
FGGYKASGIGRELGEYGLDNYTEVKTVTIKIPQKNS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcactgttttctctagaccttttcctcaagttttccgtatttcagcatgtcag
cattcaacgattcctgcaccgaacgttcacccagacgttcactataacaagattttcatc
aacaatgaatggcacgatgcagtaagcaagaaaaaatttccaaccatcaatcctgctact
ggtgaggttatctgccacgtcgcagagggcgataaggcggatgtggaaaaagctgtcaaa
gctgccaaagatgccttcaagcttgggtctccctggcggcgtatggatgcgtcccaccgc
gggcttctcttgagccgattagcagactgcatagagagagacgctgcctatttagctgaa
ctagagactcttgacaatggaaaaccatatgcagtctcctacactgtggacgtgcccatg
gtggtcaaatgcttgaggtattatgctggctgggcagacaaatgggaggggaagaccatt
cccattgatggtgattacttctgctacaccaggcatgagcccattggagtgtgtggccaa
attatcccttggaacttcccactgttgatgcaggcctggaaactcggtcctgttctggcc
acaggaaacacagtggtgatgaaggtggcagaacagacgcctctcactgcgctctatgtt
gccagtctgatcaaagaggtgggtttccctgctggtgtcgtcaacattgtcccaggaatg
ggtcccacagcaggggcagccatcgcatctcacatggatgtggacaaagtagcgttcact
ggctccactgaggtgggtcacctcatcatgaaagcctcaagtaccagtaatctgaagaag
gtcacactggagctgggaggaaagagtccaaacatcgttctatcagatgctaatatggag
gaggcagtggagcagtcccattttgccctgttcttcaaccaaggccagtgctgttgtgca
ggatctcgcacgtatgtacaggagagcatctatgatgagtttgttgagcgaagcgtagag
agagctaagaagaggattgtaggagatccctttaacttcaacacggagcagggcccccag
gtggacgaggaacagttccagaagattcttggctacatcagcagtgggaagcgtgagggc
gctaagctcatgtgcggcggcggaccggcagctgaccgcggctacttcatccagcctact
atctttggcgatgttaaagatgacatgacaattgctcgggaggagatctttggacccgtg
atgcaaattctgaagtttaaatctttagaggaagtgattgagagagccaatgacagcaaa
tacggccttgcagctgctgtttttaccaaaaacattgataaggcccattacatatccaac
ggcctgcgcgctggcactgtgtggattaactgttatgacgtgttcggagttcaggctcca
tttggaggatacaaggcctcaggaattggtcgtgagttaggagagtacggactggacaac
tacacagaggtcaaaacggttacaattaagatccctcagaaaaattcgtaa

DBGET integrated database retrieval system