KEGG   Sinocyclocheilus anshuiensis: 107662222Help
Entry
107662222         CDS       T04917                                 

Definition
(RefSeq) metalloproteinase inhibitor 3-like
  KO
K16866  metalloproteinase inhibitor 3
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sanh01002]
    107662222
Peptidases and inhibitors [BR:sanh01002]
 Peptidase inhibitors
  Family I35: timp family
   107662222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP
Motif
Other DBs
NCBI-GeneID: 107662222
NCBI-ProteinID: XP_016307646
LinkDB All DBs
Position
Unknown
AA seq 215 aa AA seqDB search
MKSCVVLAFLLFSLVCLMYQASDACSCGMSHPQDAYCHSDIVIRAKVVGKKLLNDGPFGT
LRYTVKQMKVSPSSHRQHTRSAARDHVKGDILCPFSQYNPLVCCVCVCAGRVHDGKLYTG
LCNFNERWERLSLAQKKGINHRYQLGCNCRIKPCHYLPCFVTSKNECLWTDMLSHFGFPG
YQSRHYACIQQKEGYCSWYRGMSARDKLIINTTDP
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttgtgttgtgctcgcgttcctcctgttctctctcgtctgtctgatgtaccag
gcgtcggacgcgtgttcatgcgggatgtcgcatccacaggacgcgtactgccactccgac
atcgtgatcagggctaaagtagtgggaaagaagctgctgaacgacggtccgtttggcacc
ctgcgctacaccgtcaaacagatgaaggtcagtccatcatcacacagacaacacaccaga
tctgcagcacgagatcatgttaaaggagacatattatgccccttttcacaatataatccg
ctcgtttgttgtgtttgtgtttgtgcaggtcgtgttcatgacgggaagctgtacacgggt
ctgtgtaacttcaacgagcgatgggagcgtctgtctctggctcagaagaagggcatcaat
catcgctatcagctgggctgtaactgcaggatcaagccgtgccactatctgccctgcttc
gtcacgtccaagaacgagtgtctttggacggatatgctgtcgcacttcggcttccccggc
tatcagtcgcgtcactacgcctgcatccagcagaaagagggctactgcagctggtaccga
ggcatgagcgctcgcgacaagctcattatcaacaccaccgacccctga

DBGET integrated database retrieval system