KEGG   Sinocyclocheilus anshuiensis: 107662591Help
Entry
107662591         CDS       T04917                                 

Gene name
neu4
Definition
(RefSeq) sialidase-4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00511  Other glycan degradation
sanh00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107662591 (neu4)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107662591 (neu4)
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     107662591 (neu4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3
Motif
Other DBs
NCBI-GeneID: 107662591
NCBI-ProteinID: XP_016308147
LinkDB All DBs
Position
Unknown
AA seq 433 aa AA seqDB search
MGPQYFPARSVLFQKEPSGVTYRVPALIYMPRSSCFLAFCEERLTPADAQAHLLVMRKGT
FYKNYVEWKDMEVLSTARLEGCRSMNPCPVYDEFTGTVFLFFIAVLGHTSESYQLITGKN
VTRLCYVSSSDQGDTWSSVTDLTRTLIGDTIKEWATFAVGPGHGTQLKSGRLIIPAYAYH
IDCRNCFGRKCKTSSHSFCFYSDMHGKAWHFGEALSAPESVECQMVSVDEENGVNFLYCN
ARSVSGCRVQAVSFDNGAVFHNGQLVYKLVEPKNGCHGSVIGFPAPIYELGQSQYFLRQL
RSIYTPRAVSMSPPNFLPPTWVIYTHPTCSKARRDLGVYLSLLPRDPDSWSGPWIIYAGP
SAYSDLAYVEMSTDATVVPVFACLFENGTKTAYDEISFCIFTLYELIDHLPHNNQKRKGL
RKRKGLWECCFVC
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggggcctcaatacttcccagcacgatccgtgcttttccaaaaggagccgagtggagtt
acataccgtgtgcctgctttgatctacatgcctcgttccagctgtttcttggccttctgt
gaggagagactgactccagcagacgctcaagcacatctgctggtcatgcgcaaaggcact
ttttataaaaactatgttgaatggaaagacatggaggtgttgagtacagctcgactggag
ggctgccgctcaatgaacccctgccccgtttacgatgagtttactggcacagtcttcttg
tttttcattgctgttctgggtcacacctctgagtcttaccagttaattacaggaaagaac
gtgacacgtctttgctatgtgtccagcagtgaccaaggggacacctggagctctgttaca
gaccttaccaggacgctcataggggacaccattaaagagtgggccacttttgctgtgggt
ccaggtcacggaacccaattaaaatctggaaggctaataatccctgcttatgcctaccat
attgactgcagaaattgctttggcaggaagtgcaagacttcgtcacactcgttttgtttt
tatagtgacatgcatggaaaagcgtggcattttggagaggcgttgtccgcaccagagagt
gtggagtgtcagatggtgtcagtagacgaggaaaatggagtcaactttttgtactgcaat
gcccggagtgtatcaggctgccgtgtgcaagctgttagctttgataatggggctgttttt
cacaatggccagctggtgtataaactagtggagccaaagaatgggtgccatggcagtgta
attggatttccagcgccaatctacgagctcgggcaatcccaatactttctgagacagttg
aggtccatctacaccccacgtgcagtcagcatgtcaccaccgaacttccttccaccaaca
tgggtgatatatactcaccccacctgctcaaaagcccgtcgtgacctcggtgtttacctc
agtcttctgcctcgagacccagacagctggtcaggaccttggatcatatatgcaggcccg
agtgcatattcagacttggcctatgttgagatgtctactgatgccacagtggtccctgtc
tttgcctgcctttttgagaacggcacaaagacagcttatgatgagatttccttctgcatc
ttcacactgtatgagctaatcgaccaccttccccacaacaaccaaaaaagaaaagggctc
agaaagaggaaaggattgtgggagtgctgctttgtctgctga

DBGET integrated database retrieval system