KEGG   Sinocyclocheilus anshuiensis: 107663602Help
Entry
107663602         CDS       T04917                                 

Gene name
slc7a14
Definition
(RefSeq) probable cationic amino acid transporter
  KO
K13871  solute carrier family 7 (cationic amino acid transporter), member 14
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107663602 (slc7a14)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sanh02000]
    107663602 (slc7a14)
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107663602 (slc7a14)
Transporters [BR:sanh02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   107663602 (slc7a14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C YfhO
Motif
Other DBs
NCBI-GeneID: 107663602
NCBI-ProteinID: XP_016309325
LinkDB All DBs
Position
Unknown
AA seq 764 aa AA seqDB search
MSAVFAKLDPRRIEWESSWYGLHSRILRTKPVDSMQEASADLHGTRLARVLTTVDLVSLG
VGSCVGTGMYVVAGLVAKEMAGPGVILSFIIAAVASILSGVCYAEFGVRVPKTTGSAYTY
SYVTVGEFVAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISHYMINHLGTLNGLGK
GEESYPDLLALLIAMVVTVIVSLGVKNSVSFNNALNVVNLVVWVFMVLAGLFFLSGANWE
NGRFLPYGWSGVMQGAATCFYAFIGFDIIATTGEEAKSPDTSIPYAITASLITCLTAYVS
VSVILTLLVPFNLIDGDAPLMEMFAVHGFLAGKYIVAMGAVAGLTVSLLGSLFPMPRVIY
AMAGDGLLFRFLSFVSPHTETPVVACAVSGSLAALLALLVSLRDLIEMMSIGTLLAYTLV
SVCVLLLRYQPDRDGFTSFLTKEEEEERKRKEEMMAASEKDMNSPRGEEYADNPCGAKNL
PSKGDDETLIEKSDSGGYQSDSTGCGIGENGIEVDDSASFLKRILGSHYYTIRMRLGLPN
LGDRPTPATGRTVTSCVLLFFILTFFLWTLVIYGFDRVSGGARWAMLPFIMTVIVLMVTL
VIIILRQPENPKKLPYMAPCVPFVPTAAMLVNIYLMLKLSSITWVRFVVWCSLGVLIYFS
YGMWNSSLELSAREEAAHASSYQRYDTEVDDSFNIDEDLPPQEDEQEGQYQGWAAEERSY
QYQKHYQSQQHYDEQRPSNSHNYRSKGRTNEGFEELVNEEYSPE
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgtctttgctaaactggaccccaggagaattgagtgggagtcgtcctggtat
ggactccactctcgaatcctgcgcactaaacctgtggactccatgcaggaggcctcagct
gacttgcatggcaccagactcgcccgtgtgctcactacggtggatctggtgtcacttggg
gtgggcagctgcgtgggcactggcatgtatgtggtcgccgggcttgttgctaaggaaatg
gcaggacctggagtgatcttgtccttcatcattgcagctgtggcatccattctgtcaggc
gtctgctatgctgagtttggagtgagagtgcctaaaacaacaggctccgcctacacatac
agttatgtcacagtgggagaatttgtggcctttttcattggctggaatctcattttggag
tatctgattggtacagcggcgggggccagtgcattgagcagcatgtttgactctttagcc
aatcacactatcagccactacatgatcaaccatcttggaacattgaatggcctgggtaag
ggagaggaatcttatcccgacctgctggctctgctgatcgctatggtggtgacggtgatt
gtgagtttaggggtgaaaaactctgtgagcttcaataatgcactgaatgttgttaacttg
gtcgtgtgggtctttatggtgcttgccggactgtttttcctttctggagccaactgggag
aatggaaggtttctgccctatggctggtcaggggtcatgcaaggagctgcaacctgtttc
tacgccttcattggctttgatattatcgccaccacaggagaagaggccaagagccctgac
acttccattccatatgccataacagcgtctctcatcacctgtctcacggcgtacgtctct
gtgagtgtgattctgacattgttggtgccatttaacctgattgatggcgatgccccgctt
atggagatgtttgccgttcatggcttcctggcagggaagtatattgtagccatgggtgct
gtcgcaggactcactgtcagcctgctgggatctctgttccccatgcccagagtcatctat
gccatggcgggagatggtctgcttttcaggttcctgtcctttgtgagtccgcacacagag
acccctgtggtggcctgtgctgtatcaggctctctggctgctctgttggctctcctggtg
agtctgagggacctgatcgagatgatgtccatcggcacgctgctggcctacactctggtg
tcggtgtgtgtgctgcttctgcgatatcagccagatagagacggcttcaccagtttcctc
accaaggaggaagaggaggagcggaagaggaaggaggaaatgatggcagctagtgagaag
gacatgaactcacctcgtggagaagaatatgccgacaacccctgtggagccaagaacctc
ccctccaaaggagacgacgaaacgctgattgaaaagtccgattctgggggctaccagtcg
gatagtaccggctgcggcattggagagaatggcattgaggtggatgactctgctagtttc
ttgaaacgcatattggggtcccattattacactatacggatgcgtttgggcctgccgaac
ttgggcgataggcccactcctgccacaggacgcactgttacttcctgtgtcctccttttc
ttcatcttgaccttctttctctggacgcttgtcatctatggcttcgaccgggtctcagga
ggagctcgctgggcaatgttaccttttataatgactgtaattgtcctcatggttactttg
gttataattattctccggcagccagagaaccctaaaaagctgccttacatggcaccctgt
gtgcccttcgtgcccaccgctgccatgctggtgaacatttacctcatgctcaaactatcc
agcatcacctgggtgcgctttgtggtgtggtgctcactaggtgtgctgatctattttagc
tatgggatgtggaacagctcgctggaactcagtgctagagaggaagcggctcacgccagc
tcctaccagaggtatgacacagaggtggatgacagcttcaatatcgatgaagacctccct
cctcaggaggacgaacaagagggacagtaccagggctgggcggctgaggagcgcagttat
cagtaccagaaacactaccagtcccagcagcactatgatgaacagagaccgtccaacagt
cacaattacagaagcaaaggcaggaccaatgaaggctttgaggagctggtcaatgaagag
tattcacctgagtga

DBGET integrated database retrieval system