KEGG   Sinocyclocheilus anshuiensis: 107664284
Entry
107664284         CDS       T04917                                 

Definition
(RefSeq) erythropoietin-like
  KO
K05437  erythropoietin
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107664284
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sanh04052]
    107664284
Cytokines and growth factors [BR:sanh04052]
 Cytokines
  CSF and other factors
   107664284
SSDB
Motif
Pfam: EPO_TPO TssO
Other DBs
NCBI-GeneID: 107664284
NCBI-ProteinID: XP_016310293
UniProt: A0A671NL07
LinkDB
Position
Unknown
AA seq 183 aa
MFHGSGLFALLLMVLEWTRPGLSSPLRPICDLRVLDHFIKEAWDAEAAMRACKDACSIAT
NFTAPLTRVDFDVWEAMNIEEQAQEVQSGLHVLNETISSLQASNQTDVLQSHIDASISNI
ASIRQVLRSLSIPEYVPPASGGEDKEMQNVSSISELFQVHINFLRGKVRLLLANAPVCHQ
GVS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtttcacggttcaggactctttgccttactgctgatggtgctggagtggacccgtcca
ggcctgtcctccccattacgccccatctgtgacctgcgcgtcctcgaccatttcattaag
gaggcttgggatgcagaggctgctatgagagcgtgtaaggatgcttgcagcattgcaaca
aacttcactgctcctctgacaagagttgattttgatgtctgggaagcaatgaatatagag
gagcaagctcaggaggtccagtcaggcttacatgtgctgaacgagaccatcagctcatta
caggcatctaatcagactgacgtgctgcagtcccacatagatgccagtattagcaacatt
gccagcatcagacaagtgctgcgaagtctcagcataccagaatatgtacctcctgccagt
ggtggagaagacaaggagatgcagaacgtatcctcaatctcagagctgtttcaggtccac
atcaacttcctgcggggaaaagtgcgtcttctgcttgccaatgcacctgtctgccatcaa
ggtgtcagctga

DBGET integrated database retrieval system