KEGG   Sinocyclocheilus anshuiensis: 107664459Help
Entry
107664459         CDS       T04917                                 

Definition
(RefSeq) neutral alpha-glucosidase C-like isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00052  Galactose metabolism
sanh00500  Starch and sucrose metabolism
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107664459
   00500 Starch and sucrose metabolism
    107664459
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107664459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107664459
NCBI-ProteinID: XP_016310513
LinkDB All DBs
Position
Unknown
AA seq 910 aa AA seqDB search
MEVNVSAESFESIVPGGEFQEKFKKNHDIIFYRRQRDKAVSQYFASFETLVLTDRGASLE
LCERDSQDRLCLQIRATQSGTVRVSLDELQPVKPRYHVSDVLHGELRYEPLRVNWKREDC
VCLTWGLGQYKLLVSFSPFKLEISCDGEEIVTLNPENKLYFETLQDPTRSSSDSCQDDEN
RCGLWKETFRQFEDIKANGPSSVGMDLSLHGFNHTYGLPEHADTLVLKDTSVTEAYRLYN
LDVFGYDINSRLGLYGSVPFLLAHKLERTAGVFWLNASETLVDVKYNPEPNKGEDEPPGK
KSKISPQTDVRWISESGTIDCFILLGPTAAQVFSQYAQLTGYQALPPLFSLGYHQCRWNY
EDEADVKAVDAGFDLHGIPYDVIWLDIEHTNGKRYFTWDSELFPNPGELQHHLQKKNRKL
VVISDPHIKIDPDWPLYCEVKEGGHFVKNREGAVYEGTCWPGESCYLDFSSSKTRSWYAR
QFSLSKYEGSTESLFVWNDMNEPSVFNGPEQTMPKDAVHHGGWEHRELHNLYGFYQHMAT
FEGLLTRSGGTERPFILSRSFFAGSQRLGAIWTGDNVATWEYLKISIPMLLSLSLTGIQF
CGADVGGFVQDPDPELLVRWYQAGALQPFFRGHSAKMTKRREPWLFGDDVTSAIRSAVQD
RYRLLPYWYTLFHQAHTSALPPIRPLWVEFPNDTSMFAVENQYMIGGALLVCPVTDPEVT
EVKVLLPGSDVLWYDTNTAAVHKGARTLDLPVTLNTVPVFQRGGTVVPRRAGCGSSTADL
QQHPFTLTVALDSKGNADGLLYLDDGHSFSYRDQMQFCLRRFTMRAGRLVNSCADDQGSF
VSDDKVESVVILGLNSLKRKPKLKSRVKRPKVSFCGAPKTAVTFEFDAKRGVLTLTGLDL
EIHKDWEIVI
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaatgtttcagctgaatcttttgagagcatcgtgccgggtggtgagtttcaa
gagaagtttaagaaaaaccatgacataatattctacaggagacagagagataaagcagtg
tctcaatactttgcctccttcgaaactttagtactcacagatagaggagccagtctggag
ctctgtgaacgggactctcaggatcggctgtgtcttcaaatacgggcaacccaaagtgga
acggtcagagtgtctcttgatgagctacagccggtgaaaccacgctaccatgtttcagat
gtactgcatggagagttgagatatgagccgctgagagttaattggaagagagaggactgt
gtatgtctaacttggggtctgggacagtacaagctgctggtttccttttctcctttcaaa
cttgagatttcctgtgatggagaggagattgtcactctcaacccagaaaacaaactctac
tttgagactctgcaagatccaactaggtcatcttcagattcatgccaggacgatgaaaat
cgatgtgggctgtggaaggaaacatttagacagtttgaggacatcaaagcaaatggtcct
agttctgtggggatggacttaagtctccatgggttcaaccatacgtatggtcttcctgaa
catgctgataccctggtgttgaaggacacaagtgtcacggaggcatatcggctgtacaac
ctggatgtgtttggctatgacatcaatagcaggttgggtctttatggttctgtccccttc
ctgctagctcacaagctggagaggacagctggagtgttctggctgaacgcctctgagact
ctggttgatgtcaaatacaacccagagccaaataagggcgaggatgaaccaccagggaag
aaaagcaagatctcaccacagactgatgtgagatggatatcagagagcggcacaatcgac
tgtttcattttgcttggacccacagctgcccaggtgttctctcagtatgctcaacttaca
ggctaccaggctcttcctccactcttctctttgggttatcaccaatgccgctggaactac
gaggacgaggcagatgtgaaagcagtggatgctggatttgacctccacggtattccgtat
gatgttatatggttggacatagagcacacaaatgggaagcgctacttcacctgggattcc
gagctttttccaaacccaggagaactacagcatcaccttcagaagaagaacaggaagttg
gtcgttattagtgatccgcacatcaagattgatcctgattggcctctttactgtgaagtt
aaagaaggggggcattttgtgaagaatagagaaggtgctgtttatgaaggaacatgttgg
cccggtgaatcctgttatttggacttcagtagctcaaagacaaggtcatggtatgccaga
cagttctctctaagcaaatatgaaggctcaacagaatctttgtttgtgtggaatgacatg
aatgaaccgtctgtctttaacgggccagagcagacaatgcccaaagatgcagtgcaccac
ggaggatgggaacacagggaactacacaacttgtatggcttttatcagcatatggctaca
tttgagggcttattaacccggtcaggtggcacagagaggccgtttatcctttcacgctct
ttctttgctgggtctcaaagattaggtgccatctggactggggacaatgtcgctacttgg
gagtacttgaagatttcaatacccatgctgctgtcgctgagtttgacaggaatacagttt
tgtggagctgatgtagggggctttgtgcaggatccagaccctgagcttctggtccgctgg
taccaagcaggtgctcttcagccatttttcaggggacactctgctaaaatgacaaagcgg
cgtgagccctggctgtttggggacgatgtgacctctgcgatccgctctgctgttcaggac
agataccgtctcctgccgtactggtacactctgtttcaccaagcacacacgtcagccctg
cctcccatcagacctctttgggtagagtttcccaacgatacaagcatgtttgcggtggag
aaccagtacatgattggcggtgctctccttgtgtgccctgtgacagatcctgaggtcaca
gaggtcaaggttttgctcccagggtctgatgtgctgtggtacgacacaaacacggcagcg
gtacacaagggtgccagaactttggatctgccagtgactctgaacactgtgcctgtgttc
cagcgtggggggacagtggtgcccaggagagcaggttgtgggtccagcacagcggactta
caacagcatccattcactctcactgtggccctggacagtaagggcaatgctgatggactt
ctttatctggacgatggccactcttttagttacagagaccaaatgcagttctgtctgcgc
cgttttaccatgcgagctggcaggcttgtcaacagctgtgctgatgatcaaggctcgttt
gtctcggatgacaaagtggaatcagtggtcattcttggtctgaatagcttgaaaagaaaa
cccaagctcaaatcacgtgtgaagaggccaaaagtttccttctgtggtgcgccgaagaca
gcagtcacgtttgaatttgatgcaaagcgaggtgtgttaactttaactggactggaccta
gaaatacacaaagactgggaaatagtaatttag

DBGET integrated database retrieval system