KEGG   Sinocyclocheilus anshuiensis: 107665286
Entry
107665286         CDS       T04917                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04144  Endocytosis
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107665286
   04020 Calcium signaling pathway
    107665286
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107665286
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107665286
   04540 Gap junction
    107665286
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107665286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107665286
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sanh04090]
    107665286
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107665286
Protein kinases [BR:sanh01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107665286
CD molecules [BR:sanh04090]
 Proteins
  107665286
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set Ig_5 Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 107665286
NCBI-ProteinID: XP_016311603
LinkDB
Position
Unknown
AA seq 1459 aa
MCTVSPPRGQTKLNRTIQAFRRQRVWHVSNPWPVINSDKKELILTPHSEFTITCSGERVT
WVEPLPRNSEVQSGFNHSTLVITDAVASNTGYYTCLYEDQPEKDTAIYVFVLDPEVPFVS
EPTVETDEVGTIIPCRATNPHSQVILRNLQSGDEVSVLYDPKIGFFGVLSPGHYVCEMSV
NGKAVHSIVYNVTNDKDYKENSFSIQLRASMEDVKEGDAVNLTCETAPGKAFHQQWLHPQ
KQARDAVPMKLTFPDKVQYILNIPKASVADTGRYECAVTNQLSGQTESLILGITVHKRSF
VEVISNGIGPVEVVSLLEEKEFTIYIDADPEPKVRWFKDCLQLDDSYISTKTTHLTGLRY
ENILVLRHPIEEDSGVYEIVASTGSRTSSFSFKLLVEAMYPELPQSVLAPVMWPQRDSME
VSLYSTFRLTCRGQAELSWHSPVYLHDQIDTAKKGLFISTVTVGNATAAHTGEYICYYDS
SNNTEETSIYIYVPDPETPFVPSMAPFENHVLTSHDEMEIPCRVTDPSASVSLIHIETSQ
VLSSVYDSKRGFIGLFSAGTYVCRALINGQKHDSIQYIVHGWTGGSDLRVELRAEKTALL
VGETITVDCVARGSEMLEDHWKYPGKLTDRGVKTVKENKRDLEIYYTLTVTNASPKDSGV
YACSITDIMSNESQTKQLTITVYDREFVRINPVTGPVETARLDEVREFRVDIQSFPAPKV
IWLKDGSVLGDVAAEITTNLLKIDETSYQGMLTLIRAKAEDSGNYTIRAKTGSQTTSNSF
YLQVKVPPVIVDLMDIHHGSAAGQEVVCTAGGSPTPDVEWYICKNIKHCANDSSQWMPLP
INSTDITVELQMDVDNNIESQVIFHHLESTIAVRCLARNDMGAVSREVKLVSNGPHSELT
VAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRW
EFPRDSLVLGRVLGSGAFGKVVEGTAYGLSHSQPVMKVAVKMLKPTARSSEKQALMSELK
IMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDGFLSRHTEKGKKDLD
IFGINPADESSRSYVILSFEGKSDYMDMKQADTMQYVPMLEMSEASKYSPLHRSDYDHPP
SQRQFNKSEVEKLLSDDTNEGLTTVDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLSQ
GKIVKICDFGLARDIMHDNNYISKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEI
FSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHASSDVYELMMKCWNSEPEKRPSFYSLSD
TVTSLLPSGYKRCYERVNHDFLKSDHPAVTRMQCTDNDEAYMGVLYKNQGKLKDRESGFD
EQRLSSDSGYIIPLPDLDPLSNEDYSKRNRHSSQTSEESAIETGSSSSMTKREGETLEDI
TLLDEMCLDSGEMVEDSFL
NT seq 4380 nt   +upstreamnt  +downstreamnt
atgtgtactgtgtctccacctcgtggtcaaacaaagctgaaccgaactatccaagcgttc
cgccgacaaagagtctggcatgtttcaaacccttggccggttattaattcagataaaaag
gaattaattctgacacctcattctgagttcaccatcacttgctccggagagagagtgaca
tgggttgagccgttaccgcgcaacagtgaagtgcagtctggatttaatcacagtactttg
gtgatcactgatgctgtggcctctaacacaggatattacacctgtttgtatgaggatcaa
cctgaaaaagacactgctatctatgtttttgttctagatcctgaggttccgttcgtgtct
gaacctactgttgagacagatgaggtgggcacaattatcccctgccgtgctacaaaccca
cattctcaagtgattctcagaaacctgcagagtggggatgaggtttctgtgctttacgac
cccaaaattggctttttcggtgtattatcaccgggtcactatgtctgcgagatgagcgtg
aatggcaaagcagtgcacagcatcgtttataatgtgacaaatgataaggattataaagag
aacagcttcagcatacagctgagagccagtatggaggacgtgaaagagggggatgctgtc
aatcttacctgcgagaccgctcctgggaaggctttccaccagcaatggctgcatccccaa
aaacaggccagagatgctgttccaatgaagttaacattcccagacaaggttcagtacatc
ctcaacatcccaaaagcttctgtggcagacactggacgctatgagtgtgctgtaaccaac
caattaagtggacaaaccgagtctctcatcctgggaatcacagtccataagagatctttt
gtagaagtaatatctaatggcattgggccagtggaggttgtatcgcttctggaggaaaaa
gagttcactatttacattgatgctgaccctgagccaaaggtcaggtggtttaaagattgc
cttcagctggatgacagctacatctccaccaagaccactcatctgacaggcctcaggtat
gagaatattctggttctccgccaccccatagaggaggacagtggcgtctatgagattgtt
gcgtccactggttccagaacttcaagcttttcattcaaactgctagttgaagccatgtac
ccagagctgccacagtcagtgctggctccagtgatgtggccccagagggacagcatggag
gtgtctctctactccactttcagactcacatgtcgaggtcaggccgagctctcctggcat
agccctgtttatctccacgatcagatcgacactgcaaaaaagggactcttcatctccact
gtgactgttggcaatgcgacagccgcccatacaggagagtacatctgctactatgactcc
agcaacaacactgaggagacttccatctatatttatgtgccagatccagaaacgccgttt
gtgccatccatggccccttttgaaaaccatgtgctgacgagtcatgatgaaatggagatt
ccctgccgtgtgacagaccccagcgccagcgtctctctgattcacattgagaccagtcag
gttctgtccagtgtctatgacagcaagagaggattcattggtctcttcagtgctgggacg
tatgtctgcagggccctcattaatggacagaagcatgacagcatacagtacatcgttcac
ggctggacaggagggtctgatttgcgagtcgagctgcgagcagagaagacagctctgctg
gtgggtgagaccatcactgttgactgtgtggccagaggaagtgagatgctggaggaccac
tggaaataccctgggaaactgacggatcgaggagtaaagaccgtaaaggagaataaacga
gatcttgaaatctattatactctgacagtgactaatgcctcaccgaaagacagcggtgtc
tacgcctgctccattacggatattatgagcaatgagagccaaaccaaacagctcactatt
acagtctatgatcgtgagtttgtgcgcataaatccagtaactggtccagtggagactgct
aggctggacgaggtgcgagagttcagggtggacatacagtctttccccgcccccaaagtc
atatggttaaaggacggctcggtcctgggagatgttgctgcagagatcaccaccaacctc
ctaaaaatcgatgagacaagttaccagggtatgttgaccctgatcagggctaaagcagag
gacagtgggaactataccatcagggcaaaaacaggcagccagactaccagcaacagtttc
taccttcaggttaaagtcccccctgtgattgtggacctgatggatatccaccatggctct
gctgcaggtcaggaagtggtgtgtactgctggcggctcccccacccctgacgtggaatgg
tatatctgcaaaaacattaaacactgtgccaacgattcctcccagtggatgccacttccg
atcaactctacggacataactgtggaactgcaaatggatgtggacaacaacattgagagt
caagtcattttccaccatcttgagagcacaattgctgtgcgctgtctggccaggaatgac
atgggtgctgtttcacgagaagttaaacttgtgtcaaatggtccgcactcggagctcact
gtggctgctgctgttctggtgctgctggtcattgtcatcatctcactcattgtgctggtc
attatctggaaacagaaaccacgttatgagatcagatggcgtgtgattgaatcggtcagt
ccggacggtcacgagtacatctatgtcgatcccatgcagcttccatatgactcccgctgg
gagttccctcgggattcacttgtactgggtcgtgtcctgggctcaggagcatttgggaaa
gtggtggaaggcactgcttacggactcagtcattctcaacctgtgatgaaagtggctgtg
aaaatgcttaaaccaacagcacgctccagtgagaagcaggctttgatgtcagagctgaaa
attatgacccacctgggtcctcacctaaacatcgtcaaccttctgggagcgtgcaccaaa
tcaggaccaatctacattatcacagagtattgtttctatggagacctggtgaattacctg
cataagaacagagatgggtttctcagccgccacacagaaaagggcaagaaagatctagac
atctttggcatcaacccagccgatgagagtagcaggagctacgtcatcctgtcttttgag
gggaaaagtgattatatggacatgaagcaagcagacaccatgcaatacgtccccatgctg
gaaatgagtgaagcctcaaaatactcccccctccatagatcagactacgaccatcctcca
tctcagagacagttcaacaagagtgaagttgagaaacttctctcagatgacaccaatgaa
ggcctgacaacagtggatctcctcagtttcacctatcaagtagctcgagggatggagttc
ttggcctctaagaactgtgtacacagagacttggctgcacgtaatgtcctgctgtctcaa
ggcaagatagtaaagatctgtgactttggactggccagagacatcatgcacgataacaat
tacatctccaaaggaagtactttccttccagtaaaatggatggcccctgagagtattttt
gataacttgtacactacactcagtgacgtctggtcttatggcatcttactatgggagatc
ttctcgcttggagggactccttatccaggtatggttgtggattccagcttctacaacaag
atcaagagtggataccgaatggcgaaacccgagcacgcttccagtgatgtctatgagctt
atgatgaagtgttggaacagtgaaccagagaagagaccatctttctacagcctgagtgat
acggtgacctctctgctgccctcaggatataagagatgctacgaacgcgtgaatcatgac
ttcctgaagagcgatcaccctgctgtgactcggatgcagtgcaccgacaatgatgaagcg
tacatgggtgtgctctacaagaaccagggcaaactaaaggaccgcgagagcggctttgat
gaacagagactcagctctgacagcggttacatcattcctctgccggacctcgacccactg
tcaaatgaagactacagcaaaaggaaccgccacagctctcagacgtcggaggaaagcgca
atagagacaggctctagcagctccatgacgaagcgtgagggagagaccctggaggacatc
accttgctggacgagatgtgcttggactcaggagaaatggtagaggatagtttcctgtga

DBGET integrated database retrieval system