KEGG   Sinocyclocheilus anshuiensis: 107665363
Entry
107665363         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7-like isoform X1
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04140  Autophagy - animal
sanh04310  Wnt signaling pathway
sanh04520  Adherens junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107665363
   04310 Wnt signaling pathway
    107665363
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107665363
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107665363
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107665363
   04621 NOD-like receptor signaling pathway
    107665363
   04622 RIG-I-like receptor signaling pathway
    107665363
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107665363
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107665363
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107665363
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107665363
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: TKL group
  MLK family
   107665363
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 107665363
NCBI-ProteinID: XP_016311699
UniProt: A0A671P381
LinkDB
Position
Unknown
AA seq 581 aa
MSMFSAEMLETPPVYPFEEIDYADIEVEEVVGRGAFGVVCKAKWKGRDVAIKTIESESER
NAFFVELRQLSRVNHANIVKLYGSCSNPVCLVMEYAEGGSLYNVLHGAEPLPHYTASHAM
SWCVQCSQGVSYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKG
SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHRGTRPPL
IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMSHLMRYFPGSEEPLQYPYQYSDEGQSN
SAASTGSYIDYTCTSNKNDINMEHTNSPGSNDTIKFPYKPKGDPLRPGHPLSRGGSVESL
SGRPQFLASSDSKRMSTDLSELEHRLPFAPAARPQFKRGHRKTASHGTILDIPKIIITAT
SEPHRRSSVQDLPAIGTESSQDSRNNSRASSPSVRMITPDKTDTNGSDNSIPMAYLTLDH
QLQPLAPCPNSKESMAVFEQHCKMAQEYLKVQTEIALLIQRKKELIDELDQDEKDQQNAC
RLAQEHKKLLEENKSLSTYYQQCKKQLELIRAQQQKRQGTS
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtctatgttctccgccgaaatgctggaaacaccacctgtgtacccgtttgaggagata
gactatgctgatattgaggtggaggaggtggtgggcagaggggcatttggtgttgtgtgc
aaggccaagtggaaaggcagagacgtggccatcaagactatagagagtgaatcagagaga
aatgccttctttgttgagcttcgtcagttgtcccgtgtaaatcatgccaacattgtgaag
ctgtacggttcctgcagtaaccctgtatgtctggtgatggaatatgcagaagggggttca
ttgtataatgtgctgcacggtgcagagcctcttcctcactacactgcatctcacgccatg
agctggtgcgtgcagtgttctcagggggtctcgtatctccacggcatgaaaccaaaggct
ctcattcacagggacctcaaacctcccaatctgctcctggttgctggaggtacagtgctg
aagatctgtgactttgggacagcatgtgacatccagacacacatgactaataacaaggga
agcgcagcctggatggccccagaggtgtttgaaggcagtaactacagtgagaagtgtgac
gtgttcagttggggtattattctctgggaggtgatcacacgccggaagccatttgatgaa
atcggtggccctgctttccgcatcatgtgggctgtgcaccgtggcacgcgtccacctctc
attaagaacctaccgaagcccatagagagtctgatgactcgttgctggtccaaagaccca
tcgcagcggccttccatggaggagatagtgaagattatgagccaccttatgaggtatttc
ccaggatcagaagagcctcttcagtacccttatcagtattcagatgaaggccagagtaac
tctgctgccagcacaggctcatatatagactacacatgtaccagcaacaagaacgatatc
aatatggagcacaccaactcccctggcagcaatgacaccatcaagttcccatataaacca
aagggcgacccgttaaggcctggtcaccctctctccagagggggcagtgtagagagtctt
tctggcaggccacaatttctggcttcctccgacagcaaacgaatgagcaccgatctctcc
gaactggagcacagattgccctttgctcccgcagcacgtccacaatttaagcgaggtcac
cgtaaaacggcatcacatggcaccattctggacattcccaagatcatcatcacagcaact
tctgagcctcatagacgcagttcagtgcaggatcttcctgccattggtacggagtccagt
caggatagtaggaacaacagcagagcatccagtcccagtgtgaggatgattacgccagac
aagacagacaccaatggctcagataactccatccccatggcctatttgaccctggaccat
cagttacagcctctagccccgtgtccaaactccaaagaatcaatggcagtgtttgagcag
cactgtaagatggcacaggagtacctgaaggtgcagacagagatcgctcttctcatacag
aggaagaaagagctgatagatgagctggaccaggacgagaaagatcagcagaacgcgtgt
cgcctcgctcaggagcacaagaagctcctagaggagaacaagagtctgtctacctactac
cagcagtgcaagaagcaactggagcttatccgagcacagcagcaaaagagacagggcacc
tcatga

KEGG   Sinocyclocheilus anshuiensis: 107683934
Entry
107683934         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7-like isoform X1
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04140  Autophagy - animal
sanh04310  Wnt signaling pathway
sanh04520  Adherens junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107683934
   04310 Wnt signaling pathway
    107683934
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107683934
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107683934
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107683934
   04621 NOD-like receptor signaling pathway
    107683934
   04622 RIG-I-like receptor signaling pathway
    107683934
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107683934
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107683934
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107683934
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107683934
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: TKL group
  MLK family
   107683934
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 107683934
NCBI-ProteinID: XP_016335494
UniProt: A0A671LID3
LinkDB
Position
Unknown
AA seq 581 aa
MSMFSAEMLETPPVYPFEEIDYADIEVEEVVGRGAFGVVCKAKWKGRDVAIKTIESESER
NAFIVELRQLSRVNHPNIVKLYGSCSNPVCLVMEYAEGGSLYNVLHGAEPLPHYTASHAM
SWCLQCSQGVSYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKG
SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHRGTRPPL
IKNLPKPIESLMTRCWSKDPSQRPSMEEILKIMCHLMRYFPGSEEPLQYPYQYSDEGQSN
SAASTGSYIDYTCTSNKNDINMEHTNSPGSNDTIKFPYKPKGDPLRPGHPLSRGGSVESL
SGRAHCLASSDSKRMSTDLSELEHRLPFAPAARPQFKRGHRKTASHGTILDIPKIIVTAT
CEPHRRSSVQDLPAIGMESSQDSRNNSRSSSPSVRMITPDRTDTNGSDNSIPMAYLTLDH
QLQPLAPCPNSKESMAVFEQHCKMAQEYLKVQTEIALLIQRKKELIDELDQDEKDQQNAC
RLAQEHKKLLEENKSLSTYYQQCKQQLELIRAQQQKRQGTS
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtctatgttctccgccgaaatgctggaaacaccacctgtgtacccgtttgaggagatc
gactatgctgatattgaggtggaagaggtggtgggcagaggggcatttggtgttgtgtgc
aaggccaagtggaaaggtagagatgtggccatcaagactatagagagtgaatcggagaga
aatgcctttattgttgagcttcgccagttgtcccgtgtaaatcatcccaacattgtgaaa
ctgtatggttcctgcagtaaccccgtatgtctggtgatggaatatgcagaggggggttca
ttgtataatgtgctgcacggtgcagagccccttcctcactacactgcatctcacgccatg
agctggtgcctgcagtgttctcagggggtctcttatctccacggcatgaaaccaaaggct
ctcattcacagggacctcaaacctcccaatctgctcctggttgctggaggtactgtgctg
aagatctgtgatttcgggacagcatgtgacatccagacacacatgactaataacaaggga
agcgcagcctggatggccccagaggtgtttgaaggcagtaactacagtgagaagtgtgat
gtgttcagttggggtattattctctgggaggtgatcacacgccggaagccctttgatgaa
atcggtggccctgctttccgcatcatgtgggctgtgcaccgtggcacgcgtccacctctc
attaagaacctaccaaagcccatagagagtctgatgactcgttgctggtccaaagaccca
tcgcagcggccttccatggaggagatactgaagattatgtgccaccttatgaggtatttc
ccaggatcagaagagcctcttcagtacccttatcagtattcagatgaaggccagagtaac
tctgccgccagcacaggctcatatatagactacacatgtaccagcaacaagaacgatatc
aacatggagcacaccaactcccctggcagcaatgacaccatcaagttcccatataaacca
aagggcgacccattaaggcctggtcaccctctctccagagggggcagtgtagagagtctt
tctggcagagcacattgtttggcttcctctgacagcaaacgaatgagcaccgatctctcc
gaactggagcacagattgccctttgctcccgcagcacgtccacaatttaagcgaggtcac
cgtaaaacggcatcacatggcaccattctggacattcccaagatcatcgtcacagcaacc
tgtgagcctcatagacgcagttcagtgcaggaccttcctgccattggtatggagtccagt
caggatagtaggaacaacagcagatcatccagtcccagtgtgaggatgattacgccagac
aggacagacaccaatggctcagataactccatccccatggcctacctgaccctggaccat
cagttacagcctctagccccgtgtccaaactccaaagaatcaatggcagtgtttgagcag
cactgtaagatggcacaggagtacctgaaggtgcagacagagatcgctcttctcatacag
agaaagaaagagctgatagacgagctggaccaggatgagaaggatcagcagaacgcgtgt
cgcctcgctcaggagcacaagaagctcctagaggagaacaagagcctgtctacctactac
cagcagtgcaaacagcaactggagctgatccgagcgcagcagcaaaagagacagggcacc
tcatga

DBGET integrated database retrieval system