KEGG   Sinocyclocheilus anshuiensis: 107665685Help
Entry
107665685         CDS       T04917                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 2B-like
  KO
K04145  dopamine receptor D2
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04080  Neuroactive ligand-receptor interaction
sanh04540  Gap junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107665685
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107665685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sanh04030]
    107665685
G protein-coupled receptors [BR:sanh04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    107665685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 107665685
NCBI-ProteinID: XP_016312153
LinkDB All DBs
Position
Unknown
AA seq 569 aa AA seqDB search
MRSNFTIVWGQVNSAWQDTIEVAFVAASCLVLLVTLQVGFLANLFVAWAVHHQKSLQTSN
NALLVNLAVIDILRCAIDCPLLLSVVLSARDLGVLFCSAQIASFSLICCVQLLTLACISA
ERYQAIAHPFKNAERRKRITVWIALTWLLPISISVICVIFAKDSPVYVRCRGLRIDKLGH
DTFGVYILTPIWCVCLTVIIGFYGRIFLLVRAHGRKIFDKGSLPPPDKKKEDTKHKKEEK
KTDIKNDAEKQQTFDSDHLKPNEKESREENPLDLHPTSEELTTTVGTDSLDINKPELATE
ISKETKVTFIDELSNEAPQVLEVLGEPNDHQPTSEENSSPLTNEEDGATESSTRQSTSEE
GVVPNVQQDVAAESSQSSVKGEDGEEDPNGQLHNTLGTFPPSATEEDGTVESSTSQDTSP
TSGNGDKGADKQSVPQETAAETSPASTGEATAAPQEEEVAGAICMMPSLAQRERGNAKKE
SKLAKRSGYIIFTFLIFWIPLIATVVLNHFFYQNDNLTVEVFRELEILTVSLVCMTSLTN
PIIYAAVNPQFRTEFHNLKTKWKAFFTLS
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtaatttcaccattgtttggggacaagtgaacagcgcatggcaagacactata
gaagttgcgtttgtagctgccagttgtctggttttgctggtcactttgcaggttggattt
ctggcaaacttgttcgtggcgtgggccgtgcaccaccagaagtcactccagacgtccaac
aacgctctcctggtgaatctggccgttattgacatcttgcgatgcgccattgattgtcca
ttgcttctcagtgttgttttgagcgctcgcgacctcggtgtgcttttctgcagcgcgcag
atcgcgtcgttttccctcatctgttgcgtgcagttgctcacactggcgtgcatcagcgcc
gagcgatatcaagccattgcacatccgtttaaaaatgccgagcgccgaaaacggataacg
gtgtggattgcgttgacatggcttcttcccatctccatatcggtcatttgcgtgattttt
gcgaaagactcgccggtgtacgtcagatgcagaggtttgcgcattgacaagttaggacac
gacacgtttggagtttacattttgactcccatctggtgcgtctgtttgacggtcatcatt
ggattctacggccgtattttccttttagtcagagcgcacggtcggaaaatattcgataag
ggttcgcttccaccaccggataagaagaaagaggatacaaagcacaaaaaagaagaaaaa
aagactgatattaaaaatgatgcagaaaaacaacaaacattcgatagtgatcatttaaaa
ccgaatgaaaaagagtcacgtgaagagaatccactggatttgcatccaacatctgaggaa
cttaccacaacagttggcactgactcgttggatataaacaaaccagagcttgccactgaa
atatcaaaagaaaccaaagtcacctttatagatgaactttccaatgaagcaccacaggtt
ctagaagttcttggagagccaaacgaccaccaacctacttctgaagaaaattcttctcca
ttaactaatgaagaagatggtgcgacagagtcaagcacccgccaatcaaccagtgaggag
ggtgtggtaccaaatgtccagcaagatgttgctgcagaaagttctcagtcatcagtaaaa
ggagaagatggcgaggaagacccaaatggccaactacataatactttaggaacttttcct
ccatcagctactgaagaagatggtactgttgagtcaagcacttcacaagatacgtctcca
acatcaggaaatggagataaaggtgctgataagcaaagcgttcctcaagaaactgctgca
gaaacttctccagcatcgaccggagaagccacagctgctccacaggaggaggaggtggca
ggtgccatctgtatgatgccatctctcgcccaaagagaacgaggaaacgccaagaaggag
agcaaactggccaagcgctccggatacatcatcttcaccttcctcatattttggatcccg
ctgattgcgacagtggttttaaatcacttcttttaccaaaacgacaatctaacagtggag
gtttttcgggagctggagattttaacagtgtctttggtctgcatgacatccctcaccaac
ccgatcatctatgccgcggtcaaccctcagttccgcacagaattccacaatctgaagaca
aaatggaaagcgttttttacactttcatag

DBGET integrated database retrieval system