KEGG   Sinocyclocheilus anshuiensis: 107666185
Entry
107666185         CDS       T04917                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00220  Arginine biosynthesis
sanh00330  Arginine and proline metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04146  Peroxisome
sanh04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107666185
   00330 Arginine and proline metabolism
    107666185
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107666185
   04020 Calcium signaling pathway
    107666185
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107666185
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107666185
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 107666185
NCBI-ProteinID: XP_016312860
LinkDB
Position
Unknown
AA seq 1095 aa
MGNQATKANKNVILHQTKPNTQWENKNVIPQQITPNTQWENKVNQCPFSKQVKNYQDGSC
HQDTLHHRAVKSQICTSKVCEGSIMTPKAMTRCPSSTLPSSDDILMQAIDFINQYYKSIK
NSKVEEHLSRLEEVAKEIEATGSYQLTTKELEFGAKQAWRNAPRCIGRIQWANLQLFDAR
KCRTAEDMFQMLCDHIQFATNGGNLRSAITVFPQRTDGQHDFRVWNSQLIRYAGYKMTDG
TIIGDPASVDFTEICIQLGWTPNYGQFDVLPLVLQVNREDPQFFEIPQHLILEVPMEHPQ
YKWFKDLNLRWYALPAVSNMLLEIGGLEFPACPFNGWYLGTEIGVRDFCDTQRYNVLERV
GRHMGLETQKLSSLWKDQALVAINVAVMHSFQKNKVTITDHHSASESFMQHMEMEVRLRG
GCPADWVWLVPPMSGSLTPVFHQEMLNYILSPFFYYQPDPWMTHKWKDKKRKERRHTISF
KGLIRVVLFSQTLIKSALAKRVRCTVLYATETGKSQTFAKKLNTMMNCAFSSRVVCMEDY
NFSELEKESLLIVVTSTFGNGDCPGNGESFKKQLLSLKNLRNKVRYCVFGLGSRMYPHFC
AFAHAVDARFAALGAICVSTTGEGDELNGQEEAFSAWACIAFKDACKEFNIQGQLPGKEG
LADSWDPQRHRVQNDSCTLDRITALSALHSKAVVPMKLKRRQNLQSPKSSRATILVELEM
YGSTETLNFVPGDHVGIFPGNSPELVAGVLKHLPNAPPINQSLRLEFLSAYPDGERWQRD
ERIPPCPLAQALTYYLDVTTPPSQSLLRKLSKMAKQEDHRQRLLALATDFQVYTTWKEFH
KPTFLEVLEEFSSLELSAAFLLSQLPLLKPRLYSISSSPDLHPQELHLTVAVVSYYTQEG
KGPLHFGLCSTWLNTIKEGDMVPCFVHSSDGFHLPSDPSAPCILVGVGSGIAPFRSFWQQ
QFHDVKKTGLKGNPMTLVFGCRGSDTDHLYKEETLDMRDNSTLSSIITAYSRQTGQPKVY
VQDILREQLNDKVFEVLHHNPGHLYICGGMNMAHDVAATIKEILVSRLGITLTQAEEYLS
RLKNEKRYHEDIFGS
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgggtaaccaggccactaaggccaacaagaatgtaatactgcaccagactaaaccgaat
acgcaatgggagaacaagaatgtaataccacagcagattacgccaaatacgcaatgggag
aacaaggtgaatcaatgcccattttccaagcaagtgaagaactaccaggatggctcatgc
catcaggacacattacatcacagagcggttaagagccagatttgtacgtctaaagtctgt
gaaggctctattatgactccaaaggctatgacgcgctgtccctcctccaccctgccaagc
tctgatgacatcctcatgcaagctattgacttcatcaatcagtactacaagtcaattaaa
aactcaaaagtcgaggagcatctgtctcgtttggaggaagttgcgaaggaaatagaggcc
actggctcatatcagctcaccacaaaagaattggaatttggggctaagcaagcatggaga
aatgcacccagatgcattggcagaattcagtgggctaatttgcagctgtttgatgcacgt
aaatgcagaactgctgaggatatgtttcagatgttgtgtgatcatattcagtttgctacc
aatggaggcaacctgaggtctgccataactgtgtttcctcaaagaactgatggccaacat
gatttccgtgtatggaatagtcagctcatacgatacgctggctataagatgacagatggt
acaataataggagatcctgccagtgttgacttcacagagatttgcatccagcttggatgg
acaccaaactatggtcagtttgatgtgcttccactggtgttacaagttaacagagaggac
cctcagttttttgaaattccccaacatttaattttggaagttcccatggagcacccacag
tacaagtggtttaaggatttgaatctccgatggtatgcattgcctgcggtgtccaacatg
ttgctggagattggtggtcttgaattcccagcgtgtccttttaacggttggtacttgggc
actgagattggagtgagggacttctgtgatacccaacgctacaatgttcttgagcgggtt
ggccgtcatatgggtttggagacacaaaaactgtcctcactatggaaggatcaggctctg
gtcgccatcaatgtcgcagtgatgcacagctttcagaaaaataaggtcaccattactgac
caccattctgcatcagagtccttcatgcagcacatggagatggaggtgcgtctgcgcgga
ggctgtccagccgattgggtctggctggtgccgccaatgtctggatctctaacccctgtg
tttcaccaggaaatgctgaactacatcctgtcaccctttttctactaccagcctgatcca
tggatgacacacaagtggaaagacaagaagagaaaagagaggaggcatacaatcagcttc
aaaggattgatcagagtagtgctcttctctcagacactcattaaatcagccctggccaag
agggtgcgttgcactgttctctatgccacagaaacggggaaatcacagacttttgctaag
aaactaaacaccatgatgaattgtgccttcagctcccgggtcgtttgcatggaggactac
aacttcagtgaactcgagaaggaaagcctcttaattgttgtcaccagcacctttggcaat
ggagactgtccaggaaatggagagagtttcaagaagcagcttctcagcctgaaaaacctc
agaaacaaagtgaggtactgtgtgtttggtctcggctctcgaatgtacccacacttctgt
gcgttcgcccatgcagtggatgctaggtttgcagcgctgggagccatctgtgtgtccacc
acaggagagggagatgagctgaacggacaggaggaagctttctcagcctgggcttgcatt
gcctttaaggatgcatgcaaggagtttaatattcaaggtcagcttccaggaaaagaaggt
ctggcagattcctgggatccacagaggcacagagttcagaatgacagctgtacacttgac
cgaatcacagctctgtcagctctccattctaaagcggtggttcccatgaaactgaagaga
aggcagaatctacagagcccaaagtcaagtcgtgctacaatattggtggagttagagatg
tatgggagcacagagaccttaaactttgtccctggagaccatgtagggattttcccaggg
aactcacctgaattagtagctggcgtcctgaagcatctgcccaatgcccctcctatcaat
cagagcctacgcttggaattcctcagtgcctaccctgatggtgaaaggtggcagagagat
gagcgcataccaccatgtcctcttgcccaagctcttacctactatctggatgtcaccacc
ccaccctcacaaagcctcctccgcaaactctcaaagatggcaaagcaggaagatcacaga
cagcgcctgcttgcattagcaacagatttccaagtctacacaacatggaaggagttccac
aaacctactttccttgaggtgctagaggagttttcctctctggaactttctgctgccttt
ctcctcagccagctgcctttactgaagccacgcctctactccatcagctcctccccagac
ctccaccctcaagagctccacctcactgtggccgtggtcagctattacacacaggaggga
aaaggtccactgcattttggtctctgtagtacctggctcaataccatcaaagaaggagac
atggtgccatgtttcgttcatagctctgatggattccatcttccatccgaccctagtgct
ccctgtattcttgtgggagttgggagcggcattgctcccttccgtagcttttggcaacaa
caattccatgacgtgaaaaaaacaggtctgaaagggaatccaatgacactcgtgttcggg
tgtcgaggttcagatactgatcatctttacaaagaggagactctggacatgagagataat
agcaccctaagcagtatcataacagcttactctaggcaaactggacaacccaaggtttat
gtccaagatatcttgcgagaacaactgaatgacaaggtctttgaggttctgcaccataat
ccagggcatctgtatatctgtggaggtatgaacatggcccatgatgtggctgccactatc
aaggaaatcttagtcagccggctgggcatcactcttactcaggctgaggaatatctgtca
aggctcaagaatgaaaagcggtaccatgaagacatctttggatcctag

DBGET integrated database retrieval system